KEGG   Rhodopseudomonas palustris HaA2: RPB_2737Help
Entry
RPB_2737          CDS       T00321                                 

Definition
(GenBank) protein-L-isoaspartate O-methyltransferase
  KO
K00573  protein-L-isoaspartate(D-aspartate) O-methyltransferase [EC:2.1.1.77]
Organism
rpb  Rhodopseudomonas palustris HaA2
Brite
KEGG Orthology (KO) [BR:rpb00001]
 09190 Not Included in Pathway or Brite
  09191 Unclassified: metabolism
   99980 Enzymes with EC numbers
    RPB_2737
Enzymes [BR:rpb01000]
 2. Transferases
  2.1  Transferring one-carbon groups
   2.1.1  Methyltransferases
    2.1.1.77  protein-L-isoaspartate(D-aspartate) O-methyltransferase
     RPB_2737
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PCMT Methyltransf_25 Methyltransf_31 Methyltransf_11 RrnaAD Ubie_methyltran GCD14 CMAS Methyltransf_23 Methyltr_RsmB-F TPMT DUF938 Methyltransf_4 Methyltransf_24 Methyltransf_32
Motif
Other DBs
NCBI-ProteinID: ABD07439
UniProt: Q2IWH1
Position
complement(3122296..3122949)
Genome map
AA seq 217 aa AA seqDB search
MISSVAPPPEKMLFQLSLRRRGISDRGVLQAMESVPRDRFVDAVHRDSAWRDTALPIACG
QTISQPFVVAYMTEQLHLQPGHRVLEIGTGSGYHAAVLSRLVRDVVSVERFKTLADRARA
RLKELNYANVEVVLGDGFALPEGQGTFDRILVTAAMAELPQPLLDLLDPDGILIAPIGPG
NGRQTLIRVQRKDDGFLRKPLVDVRFVPALPGIAREL
NT seq 654 nt NT seq  +upstreamnt  +downstreamnt
atgatcagttccgtggcgccgccgccggaaaagatgctgtttcaattgagcctgcgccgc
cgcgggattagcgatcgcggcgtgctgcaggcgatggaatcggtgccgcgcgaccgtttc
gtcgacgcggtgcatcgtgacagtgcctggcgcgacaccgcgctgccgatcgcctgcggc
cagaccatcagccagcccttcgtcgtcgcctatatgaccgaacagcttcatctccagccc
ggccaccgcgtgctcgagatcggcaccggctccggttaccacgccgcggtgctgtcgcgg
ctggtgcgcgacgtcgtcagcgtcgagcgcttcaagacgctcgccgaccgcgcccgcgcc
cggctgaaggaattgaactacgccaatgtcgaggtggtgctcggcgacggcttcgcgctg
ccggaggggcagggtaccttcgaccgcatcctggtgaccgcggcgatggccgaactgccg
cagccgttgctcgatctgctcgaccccgacggcatcctgatcgcaccgatcgggccggga
aacgggcggcagacgctgatccgggtgcagcgcaaggacgacggcttcctgcgcaagccg
ctggtcgacgtgcgcttcgtgccggcgctgccgggcatcgcccgcgagctctga

DBGET integrated database retrieval system