KEGG   Rhodopseudomonas palustris HaA2: RPB_2744Help
Entry
RPB_2744          CDS       T00321                                 

Definition
(GenBank) twin-arginine translocation protein TatB
  KO
K03117  sec-independent protein translocase protein TatB
Organism
rpb  Rhodopseudomonas palustris HaA2
Pathway
rpb03060  Protein export
rpb03070  Bacterial secretion system
Module
rpb_M00336  Twin-arginine translocation (Tat) system
Brite
KEGG Orthology (KO) [BR:rpb00001]
 Genetic Information Processing
  Folding, sorting and degradation
   03060 Protein export
    RPB_2744
 Environmental Information Processing
  Membrane transport
   03070 Bacterial secretion system
    RPB_2744
Secretion system [BR:rpb02044]
 Twin-arginine translocation (Tat) system
  Twin-arginine translocation (Tat) pathway protein [MD:M00336]
   RPB_2744
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: MttA_Hcf106
Motif
Other DBs
NCBI-ProteinID: ABD07446
UniProt: Q2IWG4
Position
complement(3128407..3128973)
Genome map
AA seq 188 aa AA seqDB search
MFDIGWSELVVIGVVALVAIGPKELPGVLRMVGQWMGKARKLASEFQGQFQEAMREAEMA
DLKKSFDEVKEATAGLSTNNMLTKLGSELSEAAAIDKSALDSPPVEPTTPAPPTPETFIE
ATTHQAVTGEPLAIVSEAQAAGAHTTLPVPAETHALATTDLAPPDLAHPAPAHPEPTNSE
PAKDAKAS
NT seq 567 nt NT seq  +upstreamnt  +downstreamnt
atgttcgacatcgggtggagtgaactggtcgtgatcggagtcgtcgcgctggtcgcgatc
ggtccgaaggaactccccggcgtgctgcgcatggtcgggcaatggatgggcaaggcgcgc
aagctcgcctcggaattccagggtcagtttcaggaagcgatgcgtgaggccgagatggcc
gacctcaagaagtcgttcgacgaggtcaaggaagcgaccgccggcctgtcgaccaacaac
atgctgaccaagctcggcagcgaactctccgaagccgcggcgatcgacaagagcgcgctc
gactcgccgccggtcgagccgaccacgccggcgccgccgacgcccgaaaccttcatcgaa
gccaccacgcatcaggccgtcaccggcgagccgctggcgatcgtcagtgaagcgcaggcg
gccggcgcgcatacgacgctgccggtgccggccgaaacccacgccctcgccaccaccgat
ctggcgccgccggacctggcgcatcccgcgcccgctcaccccgaacccaccaactccgaa
cccgccaaggacgccaaagcctcatga

DBGET integrated database retrieval system