KEGG   Rhodopseudomonas palustris HaA2: RPB_2751Help
Entry
RPB_2751          CDS       T00321                                 

Definition
(GenBank) Deoxyguanosinetriphosphate triphosphohydrolase
  KO
K01129  dGTPase [EC:3.1.5.1]
Organism
rpb  Rhodopseudomonas palustris HaA2
Pathway
rpb00230  Purine metabolism
Brite
KEGG Orthology (KO) [BR:rpb00001]
 09100 Metabolism
  09104 Nucleotide metabolism
   00230 Purine metabolism
    RPB_2751
Enzymes [BR:rpb01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.5  Triphosphoric-monoester hydrolases
    3.1.5.1  dGTPase
     RPB_2751
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: HD_assoc HD HDOD
Motif
Other DBs
NCBI-ProteinID: ABD07453
UniProt: Q2IWF7
Position
complement(3136057..3137271)
Genome map
AA seq 404 aa AA seqDB search
MSVGMAAPRAAFSCDPDRSRGRQFAEPPSSNRSAFRRDCDRVIHSNAFRRLKHKTQVFVF
HEGDHYRTRLTHSLEVAQIARAIARQLGLDEDLTETLALAHDLGHPPFGHAGERALDACL
RDHGGFDHNAQTLRVLTALEHRYPGFDGLNLTWETLEGVVKHNGPLTDRTGAPLPRHAER
GVPIGIAEFSQRFDLEIWSFASLEAQVAALADDIAYDAHDIDDGLRAGLFRVDDLRAVPL
TAALIDGISRRYPALGESRRGAELVRELISHLIGAVTAETMRRLGEAAPRSVEDVRHAST
AMVAFPSETAVAEAEIKAFLWTHMYRAERVMAVMRDAEAIVADLFRRYCEHPADLPPDWL
PADGPVAECEADRFRRIRNFIAGMTDRYALTEHQRLFDSTPDLR
NT seq 1215 nt NT seq  +upstreamnt  +downstreamnt
gtgtcggtcggaatggcagctcctcgcgcagcttttagctgcgacccggaccgcagccgc
ggccggcaattcgccgagccgccgagcagcaaccgcagcgcgttccgccgcgattgcgac
cgggtgatccattccaatgccttccgtcggctgaagcacaagacccaagtcttcgtgttt
cacgagggcgatcattaccgcacccggctgacccacagcctggaagtggcccagatcgcc
cgcgccatcgcgcgccagctcgggctcgacgaagatctgaccgagacgctggcgctggcg
cacgacctcggccatccaccgttcggccatgccggcgagcgagcgctcgacgcctgtctg
cgagaccacggcgggttcgaccacaacgcgcagacgctgcgggtgctgacggcacttgag
caccgctatccaggcttcgacgggctgaacctgacctgggaaacgctcgaaggcgtggtc
aagcacaacggcccgctgaccgatcgcaccggagcgccgctgccgcgccatgccgagcgt
ggcgtgccgatcggcattgccgaattcagccaacgcttcgatctcgaaatatggagcttc
gcctcgctcgaagcccaggtcgcggcgcttgccgacgacatcgcctacgacgcccacgac
atcgacgatggtcttcgcgccgggttgttccgggtcgacgatctgcgcgccgtgccgctg
accgccgccctcatagatggcatttcgcgacgctatccggcgctgggcgagagccgtcgc
ggcgccgaactcgtccgcgagctgatttcgcatctgatcggcgccgtcacggcagagacc
atgcgccggctcggcgaggcggcgccacgatcggtcgaggacgtgcgccacgccagcacg
gcgatggtcgcgtttccgtccgaaacggccgtcgcggaggccgagatcaaagcctttctc
tggacccatatgtaccgcgccgagcgggtcatggcggtgatgcgggacgccgaggcgatc
gtcgccgacctgttccggcggtattgcgagcatcccgccgacctgccgccggactggctg
ccggccgatggcccagtggccgaatgcgaggccgaccgctttcgccggatccgtaatttc
atcgccggcatgaccgaccgctacgctttgaccgaacatcagcggctttttgactcgacc
ccggatttgcgttag

DBGET integrated database retrieval system