KEGG   Rhodopseudomonas palustris HaA2: RPB_2753Help
Entry
RPB_2753          CDS       T00321                                 

Definition
(GenBank) conserved hypothetical protein
Organism
rpb  Rhodopseudomonas palustris HaA2
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: dCache_3 LapA_dom
Motif
Other DBs
NCBI-ProteinID: ABD07455
UniProt: Q2IWF5
Position
3137955..3138974
Genome map
AA seq 339 aa AA seqDB search
MPVPASVPLPPRPLTSFRVGLITALVLAALFGVMIAITFSMQNEVIARDRDNQMAAVSQA
ITSALDQAGRFALTQAETTARQTGISGALAAGDRAALSNLAGGTYNYLKTQGVPVFGFHA
ADMTYLLRLHLPDKFGDDLTKIRPMVLAANKTRHSQVGLEIGVAGTFVRGIAVIHDGDRF
VGTVEAGLNLEPILEQVKTLTNADIAVVLSQSLTGLPPHGAGNTSAGEQFGDLIALASTD
MPLFSGLLREGAIRLARTREVASYRIRDDSGAVLVQPLIDFSGRMIGNVAAVKVFPTHGA
ALQRTRTELIAAALIGAILAFVVFAVMARMIAMRGGPQG
NT seq 1020 nt NT seq  +upstreamnt  +downstreamnt
atgcctgtgcctgccagcgtcccgctccctccccgtcccctcaccagcttccgcgtcggc
ctgatcaccgcgctggtgctggcggcgctcttcggcgtcatgatcgcgatcaccttctcg
atgcagaacgaggtgatcgcgcgcgaccgcgacaaccagatggccgcggtcagccaagcg
atcacctcggcgctggatcaggccggacgcttcgcgctgacccaggccgagacgactgcc
cgccagaccgggataagcggcgctctggcggccggtgatcgcgccgcactgtccaacctt
gccggcggcacctacaattatctcaagacacagggcgtgccggtgttcggctttcacgcc
gccgacatgacctatctgctgcgactgcacctgcccgacaaattcggcgacgacctgacc
aagattcgtccgatggtgctcgccgccaacaagaccaggcactcgcaagtcgggctcgaa
atcggcgtcgccggcaccttcgtgcgcggcattgcggtgatccacgacggcgaccgcttc
gtcggcacggtggaggccggcctcaacctcgaaccgatcctcgagcaggtcaaaacgctg
accaacgccgacatcgccgtggtgctcagccaatcgctcacaggcctgccgccgcatggt
gccggcaatactagcgccggcgaacaattcggtgacctgatcgcattggcctcgaccgat
atgccattgttcagtggcctgctgcgcgagggcgcaatccggctggcacgcacccgcgaa
gtggcttcgtatcggattcgcgacgacagcggcgctgttctggtacagccgctgatcgat
ttttccggccggatgatcggaaacgtcgccgccgtcaaagtcttcccgacacatggcgcg
gctctgcagcggacacgcaccgagctgatcgcggcggcgctgatcggcgccatcctcgcc
tttgtcgtcttcgcggtgatggcgcggatgatcgccatgcgcggcggcccgcagggatga

DBGET integrated database retrieval system