KEGG   Rhodopseudomonas palustris HaA2: RPB_3607Help
Entry
RPB_3607          CDS       T00321                                 

Definition
(GenBank) acetyl-CoA acetyltransferase
  KO
K00626  acetyl-CoA C-acetyltransferase [EC:2.3.1.9]
Organism
rpb  Rhodopseudomonas palustris HaA2
Pathway
rpb00071  Fatty acid degradation
rpb00072  Synthesis and degradation of ketone bodies
rpb00280  Valine, leucine and isoleucine degradation
rpb00310  Lysine degradation
rpb00362  Benzoate degradation
rpb00380  Tryptophan metabolism
rpb00620  Pyruvate metabolism
rpb00630  Glyoxylate and dicarboxylate metabolism
rpb00640  Propanoate metabolism
rpb00650  Butanoate metabolism
rpb00900  Terpenoid backbone biosynthesis
rpb01100  Metabolic pathways
rpb01110  Biosynthesis of secondary metabolites
rpb01120  Microbial metabolism in diverse environments
rpb01130  Biosynthesis of antibiotics
rpb01200  Carbon metabolism
rpb01212  Fatty acid metabolism
rpb02020  Two-component system
Brite
KEGG Orthology (KO) [BR:rpb00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00620 Pyruvate metabolism
    RPB_3607
   00630 Glyoxylate and dicarboxylate metabolism
    RPB_3607
   00640 Propanoate metabolism
    RPB_3607
   00650 Butanoate metabolism
    RPB_3607
  09103 Lipid metabolism
   00071 Fatty acid degradation
    RPB_3607
   00072 Synthesis and degradation of ketone bodies
    RPB_3607
  09105 Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    RPB_3607
   00310 Lysine degradation
    RPB_3607
   00380 Tryptophan metabolism
    RPB_3607
  09109 Metabolism of terpenoids and polyketides
   00900 Terpenoid backbone biosynthesis
    RPB_3607
  09111 Xenobiotics biodegradation and metabolism
   00362 Benzoate degradation
    RPB_3607
 09130 Environmental Information Processing
  09132 Signal transduction
   02020 Two-component system
    RPB_3607
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:rpb04147]
    RPB_3607
Enzymes [BR:rpb01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.9  acetyl-CoA C-acetyltransferase
     RPB_3607
Exosome [BR:rpb04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   RPB_3607
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Thiolase_N
Motif
Other DBs
NCBI-ProteinID: ABD08302
UniProt: Q2IU08
Position
4138945..4140456
Genome map
AA seq 503 aa AA seqDB search
MASQLPPERIPVIAGIGEIADHPKDIAQGLEPLALLEQAARRAGDDSSVHLLREIDSLDI
VNFLSWRYHAPEQQLAAKLGVSPRHCYYGPVGGESPIRFIHEAALRIARGEAHVAVVCGA
EAQSTVTKAARAKLELPWTPFASDAPEPKRGAAFQKPIATQLGVARPITVYPLYEAATAA
HWGQTPRQALDESGVLWSRYAQAAAANPNAWIKRAFAPSEITTPSPDNRLIAWPYTKLMV
ANPSVNLGAAVLLTSLAKAREAGIAEEKLIYIHGGASAEEPRDYLARDQFHQSHAQNAVL
ETIKAMVGGDGRVFDAIELYSCFPVVPKMARRTLGLGDDVQPTVTGGLTFFGAPLNTYMT
HAACAMVRRLRGGARLGLLYGQGGFVTKHHALVLSRTPSQQALSESVSVQTKADAAYGDV
PPFVTDASGDGTVESFTVIFTGKGDVEHGVVVLRTSDGARTLARVPAQDQATLAVLTNMD
RSPVGTNGPITTSADGVLEWRAV
NT seq 1512 nt NT seq  +upstreamnt  +downstreamnt
atggccagccaactcccgcccgagcgcattcccgtcatcgccggaatcggcgaaatcgcc
gatcaccccaaggacattgcgcaagggctggagccgctggcgctgctcgaacaggcggcg
cgacgcgccggcgacgacagctctgtgcatctgctgcgcgagatcgactcgctcgatatc
gtcaacttcctgagctggcgctatcacgcgcccgagcagcagctcgccgcgaaactcggc
gtttcgccgcggcactgctactacgggccggtcggcggcgagagcccgatccgcttcatc
cacgaagcggcgctgcggatcgcgcgcggcgaagcgcacgtcgccgtggtctgcggcgcc
gaggcgcaatcgaccgtcaccaaggcggcgcgcgccaagctcgaattgccgtggacgccg
ttcgcgagcgacgcgcccgaaccgaagcgcggcgccgcgttccagaagccgatcgccacg
cagctcggcgtcgcgcggccgatcaccgtgtatccgctgtacgaggcggcgacggccgcg
cattggggccagacgccgcggcaggcgctcgacgaatccggcgtgctgtggtcgcgctac
gcgcaggccgccgcggccaatccgaacgcctggatcaagcgcgccttcgcaccgagcgag
atcaccacgccctcgcccgacaaccggctgatcgcctggccctataccaagctgatggtc
gccaatccgagcgtcaatctcggcgcggcagtgctgctgacctcgctggcgaaggcacgc
gaggcaggcatcgccgaggaaaaactgatctacatccatggcggcgcctcggccgaagag
ccgcgcgattatctcgcccgcgatcaattccaccagagccacgcccagaacgcggtgttg
gagacgataaaggcgatggtcggcggcgacggccgcgtgttcgacgcgatcgagctgtat
tcctgcttccctgtggtgccgaaaatggcgcggcgcacgcttgggctcggcgacgacgtg
cagccgacggtgaccggcggcctcaccttcttcggcgcgccgctcaacacctatatgacc
cacgcggcctgcgcgatggtgcgcaggctgcggggcggcgccaggctcggcctgctgtat
ggacaggggggcttcgtcaccaagcaccacgcgctggtgctgtcgcgcacgccatcgcaa
caagcgctgagcgagagcgtcagcgtacagacgaaggccgatgcggcttacggcgacgtc
ccgccgttcgtgacagacgcctcgggcgacggcacggtcgagagcttcaccgtgatcttc
accggcaagggcgacgtcgaacacggcgtcgtggtgctacgcacctcggacggcgcgcgc
acgctggcgcgggtgccggcgcaggatcaggcgacgctggccgtgctgacgaacatggat
cgcagtccggtcggcacgaacggtccgatcacgacgagcgccgatggcgtgctggagtgg
cgtgctgtctag

DBGET integrated database retrieval system