KEGG   Rhodopseudomonas palustris HaA2: RPB_3977Help
Entry
RPB_3977          CDS       T00321                                 

Definition
(GenBank) magnesium protoporphyrin O-methyltransferase
  KO
K03428  magnesium-protoporphyrin O-methyltransferase [EC:2.1.1.11]
Organism
rpb  Rhodopseudomonas palustris HaA2
Pathway
rpb00860  Porphyrin and chlorophyll metabolism
rpb01100  Metabolic pathways
rpb01110  Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:rpb00001]
 09100 Metabolism
  09108 Metabolism of cofactors and vitamins
   00860 Porphyrin and chlorophyll metabolism
    RPB_3977
Enzymes [BR:rpb01000]
 2. Transferases
  2.1  Transferring one-carbon groups
   2.1.1  Methyltransferases
    2.1.1.11  magnesium protoporphyrin IX methyltransferase
     RPB_3977
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Mg-por_mtran_C Methyltransf_25 Methyltransf_11 Methyltransf_31 Methyltransf_12 Methyltransf_23 PrmA Cons_hypoth95 MTS Methyltransf_2 CMAS Methyltransf_32 PCMT tRNA_U5-meth_tr Ubie_methyltran Methyltransf_18 NodS MethyltransfD12 TPMT TehB
Motif
Other DBs
NCBI-ProteinID: ABD08670
UniProt: Q2ISZ0
Position
complement(4540607..4541308)
Genome map
AA seq 233 aa AA seqDB search
MALGSYIERRGELETYFDRTAADTWAKLTSDAPVSGIRATVRAGRDEMRNTLLSWLPADM
TGTRLLDAGCGTGALSIAAARRGAKVLAIDLSPTLVGVARERLPEDIDPAAIDFRSGDML
DSALGEFDFVVAMDSLIHYLPHDICRILATLASRTRRSMAVTFAPKTPALALMHFVGGFF
PRADRAPAIEPVSEKKLLKLISEEPQLTQWQPGRTHRVSSGFYTSQALEMVRR
NT seq 702 nt NT seq  +upstreamnt  +downstreamnt
atggcgttgggcagctacatcgagcgacgtggagagcttgaaacctatttcgaccgcacc
gcggccgatacttgggccaagctgacgtcggatgccccggtcagcggcatccgtgccacc
gtgcgcgccggccgcgacgaaatgcgcaacacgctgttgtcctggctgccggccgatatg
accggtacccgcctgctcgacgccggctgcggcaccggtgcgctgtcgatcgcggcggcg
cggcgcggcgcgaaggtgctggcgatcgacctgtcgccgacgttggtcggcgtcgcgcgt
gaacgcctgccggaagacatcgatccggcggcgatcgatttccgttccggcgatatgctc
gattccgcgctcggcgaattcgatttcgtcgtcgcgatggactcgctgatccactatctg
ccgcatgatatctgccggatcctcgcgacgctggcgtcgcggacccggcggtcgatggca
gtgacgttcgcgccgaagacgccggcgctggcgctgatgcatttcgtcggcggtttcttc
ccgcgcgccgatcgggccccggcaatcgagccggtcagcgagaagaagctgctgaaactg
atttccgaagagccgcagctgacgcagtggcagcccggccggacccaccgcgtgtcgtcc
ggtttctacacctcgcaggccttggagatggttcgacgatga

DBGET integrated database retrieval system