KEGG   Rhodopseudomonas palustris HaA2: RPB_4199Help
Entry
RPB_4199          CDS       T00321                                 

Definition
(GenBank) isocitrate lyase
  KO
K01637  isocitrate lyase [EC:4.1.3.1]
Organism
rpb  Rhodopseudomonas palustris HaA2
Pathway
rpb00630  Glyoxylate and dicarboxylate metabolism
rpb01100  Metabolic pathways
rpb01110  Biosynthesis of secondary metabolites
rpb01120  Microbial metabolism in diverse environments
rpb01200  Carbon metabolism
Module
rpb_M00012  Glyoxylate cycle
Brite
KEGG Orthology (KO) [BR:rpb00001]
 Metabolism
  Carbohydrate metabolism
   00630 Glyoxylate and dicarboxylate metabolism
    RPB_4199
Enzymes [BR:rpb01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.3  Oxo-acid-lyases
    4.1.3.1  isocitrate lyase
     RPB_4199
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ICL PEP_mutase
Motif
Other DBs
NCBI-ProteinID: ABD08891
UniProt: Q2ISB9
Position
complement(4770642..4772279)
Genome map
AA seq 545 aa AA seqDB search
MNFQPRGISDLAAQKPASYQSQIEAAEALLKDQPTWNGVKAEAVARMRLQNRFKTGLDVA
RYTAALMRADMAAYDADSTKYTQSLGCWHGFIAQQKLISVKKHFNTTDRTYLYLSGWMIA
ALRSEFGPLPDQSMHEKTSVPALIEELYTFLRQADARELNTIFRDLDAARKAGDKAKETA
LIEKIDNFQTHVVPVIADIDAGFGNAEATYLLAKKMIEAGACALQIENQVSDEKQCGHQD
GKVTVPHEVFLAKIRACRHAFLELGVEDGIIVTRTDSLGAGLTQQIAVSHAPGDIGDQYN
SFLDCEEVDVTSVGNGDVIISREGKLLRPKRLPSNLYQFREGTGADRCVLDCITSLQNGA
DLLWIETEKPNIAQIASMVDRIREVIPNAKLAYNNSPSFNWTLNFRWQVYDEMKAAGKDV
SQYNRAELMKAEYDETPLAKEADEKIRTFQADSAKRAGIFHHLITLPTYHTAALSTDNLA
KEYFGEQGMLGYVKNVQRQEIRQGIACVKHQDMAGSNIGDDHKEYFAGEAALKAGGAHNT
MNQFG
NT seq 1638 nt NT seq  +upstreamnt  +downstreamnt
atgaatttccagccgcgtgggatcagcgatctggccgcccagaagcccgcctcctatcag
agccaaatcgaggcggccgaagcgctcctcaaggaccagcccacctggaacggcgtcaag
gccgaagctgtggcccggatgcgcctgcagaaccgtttcaagaccggcctcgacgtcgcg
cgctacaccgccgcgctgatgcgcgccgacatggcagcctatgacgccgacagcaccaaa
tatacccagtcgctcggctgctggcacggcttcatcgcgcagcagaagctgatttcggtg
aagaagcatttcaacaccaccgatcgcacctacctgtatctgtccggctggatgatcgcg
gcgctgcgctccgaattcggcccgctgcccgaccagtcgatgcacgagaagacctcggtg
ccggcgctgatcgaagagctctacaccttcctgcgtcaggccgacgcccgtgagctcaac
acgattttccgcgacctcgacgccgcccgcaaggccggcgacaaggccaaggaaaccgcg
ctgatcgaaaagatcgacaatttccagacccacgtcgtgccggtgatcgccgacatcgac
gccggcttcggcaatgccgaggcgacctatctgctcgccaagaagatgatcgaggccggc
gcctgcgcgctgcagatcgagaaccaggtgtccgacgaaaagcagtgcggccatcaggac
ggcaaggtgacggtgccgcacgaggtcttcctggcgaagatccgcgcctgccgccacgcc
ttcctcgaactcggcgtcgaagatggcatcatcgtcacccgcaccgattcgctcggcgca
ggcctgacccagcagatcgccgtcagccatgcgcccggcgacatcggcgaccagtacaac
agcttcctggattgcgaagaggtcgacgtgacgtcggtcggtaatggcgacgtcatcatc
agccgcgagggcaagctgctgcgcccgaagcgtctgcccagcaacctgtaccagttccgc
gaaggcaccggtgcggatcgctgcgtgctcgactgcatcacctcgctgcagaacggcgcc
gacctgctgtggatcgagaccgagaagccgaacatcgcgcagatcgcctcgatggtcgat
cggatccgcgaagtgatcccgaacgccaagctggcctacaacaactcgccgtcgttcaac
tggaccctcaacttccgttggcaggtctacgacgagatgaaggcggccggtaaggacgtc
agccagtacaatcgggccgagctgatgaaggcggaatacgacgagacgccgctggcgaag
gaagccgacgagaagatccggaccttccaggccgattcggccaagcgcgccggcatcttc
catcatctgatcacattgccgacctatcacacggcagcgttgtcgaccgacaatctcgcc
aaggaatattttggcgaacagggcatgctggggtatgtcaagaacgtgcagcgccaggaa
atccgtcaggggatcgcctgcgtcaagcaccaggacatggccggctcgaacatcggcgac
gaccacaaggaatacttcgccggcgaggccgctttgaaggccggcggcgcccacaacacg
atgaaccagttcggctaa

DBGET integrated database retrieval system