KEGG   Rhodopseudomonas palustris BisB18: RPC_0609
Entry
RPC_0609          CDS       T00336                                 

Name
(GenBank) hypothetical protein
Organism
rpc  Rhodopseudomonas palustris BisB18
SSDB
Motif
Pfam: Legionella_OMP Mto2_bdg
Other DBs
NCBI-ProteinID: ABD86182
UniProt: Q21BQ4
Position
complement(660913..662127)
AA seq 404 aa
MTPFTKPALLIGLALTASTLPQIGHAASAEEQITARLNALEKENAGLRARLNRLETAKAA
KPMPPAPQNTNLAAMPQRPVGEIYGKAPVAIIHPAPRQAFEVSGSLLLLQSASGNMEYAT
LINPLPLVSPHWNNQALEPDFAAAFDLGARYMNGANDIAVQWTHLKATTNASFEGTPDQM
VGPPYLIGPESALYKVGRGSLQAEFDSVKMDVGHTFCVDCDFQMRAFGGVEFARIGQDLT
GTAESRDASASSSYTNHSKFTGAGPRIGVKSQYSLGSFDFSGEIGGAALIGTMQSRVDYL
TVKPALAQPTVQYLASPNATRVIPSVNARLATAYNFAPTAYGLFKVEVGYQAAVYFDAVG
EYAVTQVPTSLVLPPNGVYLATAQHLTSNFTTHGPFMTAKWQFQ
NT seq 1215 nt   +upstreamnt  +downstreamnt
atgacgccattcacaaagcctgcgctgctgataggcttggcgctgaccgcttcgaccctt
ccgcagatcggacatgcggccagcgcagaggagcagatcaccgcaaggctgaatgccctg
gagaaggaaaatgccgggctgcgtgcccgcctcaaccggctggaaaccgccaaagcggcg
aagccgatgccgcccgctccgcagaatacaaacttggctgcgatgccgcagcggcctgtt
ggcgagatctacggcaaggccccggtcgcgatcatccacccggcgccgcggcaggctttc
gaagtcagcggctcgctgctgctcttgcagtcggcgtccggcaacatggaatatgccacg
ctgatcaacccgttgccgctggtgtcgccgcactggaacaatcaggcgctggagcccgac
ttcgccgccgccttcgacctcggcgcgcgctacatgaacggcgccaacgacatcgccgtg
caatggacgcatctgaaagccaccaccaacgcctcgtttgaaggcacgcctgaccagatg
gtcggtccgccctacctgatcggcccggaatcggcgttgtacaaggtcggccgcggctcg
ctgcaggccgaattcgactcggtcaaaatggacgtcggacatacgttctgtgtcgattgc
gatttccagatgcgcgccttcggcggcgtggagttcgcccggatcggccaggatttgacc
ggcacggcggagagccgcgacgcctcggcgtcgagttcctacaccaaccattcgaaattc
accggcgccggcccccggatcggcgtgaagagccagtattcgctcggcagcttcgatttc
tcgggtgaaatcggcggcgcggcgctgatcggcaccatgcagagccgggtcgactacctg
accgtcaagccggcgctggcgcagccgaccgtgcaatatctggcctcgcccaacgcgacc
cgggtgatccccagcgtcaacgcaaggctcgccaccgcgtataattttgcgccgaccgct
tacgggctgttcaaggtcgaggtcggttatcaggcggcggtgtatttcgacgcggtcggc
gaatatgccgtgacacaggtaccgacctcgctggtgctgccgccgaacggcgtctatctg
gccaccgcgcagcatctgaccagcaacttcaccacccacggcccgttcatgaccgcgaag
tggcagttccagtag

DBGET integrated database retrieval system