KEGG   Rhodopseudomonas palustris BisB18: RPC_1316Help
Entry
RPC_1316          CDS       T00336                                 

Definition
(GenBank) light-independent protochlorophyllide reductase, iron-sulfur ATP-binding protein
  KO
K04037  light-independent protochlorophyllide reductase subunit L [EC:1.3.7.7]
Organism
rpc  Rhodopseudomonas palustris BisB18
Pathway
rpc00860  Porphyrin and chlorophyll metabolism
rpc01100  Metabolic pathways
rpc01110  Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:rpc00001]
 09100 Metabolism
  09108 Metabolism of cofactors and vitamins
   00860 Porphyrin and chlorophyll metabolism
    RPC_1316
Enzymes [BR:rpc01000]
 1. Oxidoreductases
  1.3  Acting on the CH-CH group of donors
   1.3.7  With an iron-sulfur protein as acceptor
    1.3.7.7  ferredoxin:protochlorophyllide reductase (ATP-dependent)
     RPC_1316
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Fer4_NifH CbiA AAA_31 ArsA_ATPase ParA MeaB MipZ AAA_26 AAA_24 SRP54 CBP_BcsQ NB-ARC AAA_25
Motif
Other DBs
NCBI-ProteinID: ABD86878
UniProt: Q219Q8
Position
1433674..1434612
Genome map
AA seq 312 aa AA seqDB search
MNILTDPAKLKTAGCADTNASKCSEGDGEGSVQVQLDPNLKIGTAKVFSIYGKGGIGKST
TSSNLSVAFSKLGKRVLQIGCDPKHDSTFTLTKRLVPTVIDVLESVNFHSEELRPEDFVF
EGYNGVMCLEAGGPPAGTGCGGYVVGQTVKLLKEHHLLEDTDVVIFDVLGDVVCGGFAAP
LQHSERAMIVAANDFDSIFAANRIAAAIAAKSKNYGVRLGGIIANRSRETDQIDKFGERT
GIRRIAHLPDLDVIRKSRLKKMTLFEMDHTDEILAVQQEYLRLATEMLEGKEPPIDGKPL
KDRDIFDLLGFD
NT seq 939 nt NT seq  +upstreamnt  +downstreamnt
atgaacattctgaccgatcccgccaagctgaagaccgcaggctgcgccgacaccaacgcc
tcgaaatgcagcgagggcgacggcgagggcagcgtccaggtgcagctcgatcccaacctg
aagatcggcaccgccaaggtgttctcgatctacggcaagggcggcatcggcaagagcacg
acctcgtcgaacctgtcggtggcgttctccaagctcggcaagcgcgtgctgcagatcggc
tgcgaccccaagcacgactccaccttcacgctgaccaagcggctggtgccgaccgtgatc
gacgtgttggaatcggtgaacttccactccgaggaactgcgccccgaagacttcgtgttc
gagggttacaatggcgtgatgtgcctggaagcaggtggccccccggcgggaaccggttgc
ggcggctacgtggtcgggcaaaccgtgaagcttcttaaggaacatcatctgctcgaagat
accgacgtggtgatcttcgacgtgctcggcgacgtggtgtgtggcggttttgccgcgccg
ttgcagcattccgaacgcgcgatgatcgtggcggccaatgatttcgattcgattttcgcg
gcgaaccggatcgccgcggcgattgcggcgaaatcgaagaactacggcgtgcggctcggc
ggtatcattgccaaccgctccagggaaaccgaccagatcgacaaattcggcgagcggacc
ggtatcaggcggattgcgcatctccccgatctcgatgtcatccgcaagagtcgtctgaaa
aagatgacactctttgagatggatcacaccgacgaaattctggccgtgcaacaagagtac
cttcggcttgccactgaaatgttggaaggcaaggaaccgccgattgacggcaagccgctg
aaggatcgcgatatctttgacctcttgggatttgattga

DBGET integrated database retrieval system