KEGG   Rhodopseudomonas palustris BisB18: RPC_1352Help
Entry
RPC_1352          CDS       T00336                                 

Definition
(GenBank) Gamma-glutamyltransferase
  KO
K00681  gamma-glutamyltranspeptidase / glutathione hydrolase [EC:2.3.2.2 3.4.19.13]
Organism
rpc  Rhodopseudomonas palustris BisB18
Pathway
rpc00430  Taurine and hypotaurine metabolism
rpc00460  Cyanoamino acid metabolism
rpc00480  Glutathione metabolism
rpc01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:rpc00001]
 09100 Metabolism
  09106 Metabolism of other amino acids
   00430 Taurine and hypotaurine metabolism
    RPC_1352
   00460 Cyanoamino acid metabolism
    RPC_1352
   00480 Glutathione metabolism
    RPC_1352
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01002 Peptidases and inhibitors [BR:rpc01002]
    RPC_1352
Enzymes [BR:rpc01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.2  Aminoacyltransferases
    2.3.2.2  gamma-glutamyltransferase
     RPC_1352
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.19  Omega peptidases
    3.4.19.13  glutathione gamma-glutamate hydrolase
     RPC_1352
Peptidases and inhibitors [BR:rpc01002]
 Threonine peptidases
  Family T3: gamma-glutamyltransferase family
   RPC_1352
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: G_glu_transpept Het-C
Motif
Other DBs
NCBI-ProteinID: ABD86914
UniProt: Q219M2
Position
1472534..1474120
Genome map
AA seq 528 aa AA seqDB search
MRNFQFAGRSTVHARNAMVATSHPQASLAAIETLRAGGNAADAAIAASALLAVIEPQSTG
IGGDCFALYQPGGQGSIVSYNGSGRAPQAAHAEWFVEQGINAIPLTSPHAVTIPGAIDAW
ATILRDHGRFGLDTLLQPAIKAADDGYVVAPRIAFDWANGFAKLKKGVNTARYLLPRGEA
AVTGDVIRQPELAETLRLIAKLGPDGFYKGAVAEDMVATLRGLGGLHTLEDFATHATETT
TPISTSYKGHDVWQCPPNGPGITMLVMLNVLSLFDLSKYAPLSVERFHLEAEAARIAYLM
REQHIGDPGHVDVDVIRILSREFAAEYGSQIKMDRLLDLPKVSPPMNPSTVYITVVDQDR
NVCSFINSIAHSFGSAIISEKTGVLLQNRGAGFRVQPGHPNCIAPGKRPLHTIIPSLATE
NGRAKLSFGVMGGQYQPVGQVHVLTNMLDFGLDMQQAIDLPRGLHYEGVYQLEDGVPADV
VDGLRKIGHDIAGLSVPHGGGQGVWIDWEKGTLTGGSDPRKDGCALGY
NT seq 1587 nt NT seq  +upstreamnt  +downstreamnt
atgaggaatttccagttcgccggccgctccacggtccatgcccgcaacgccatggtggcg
acctcgcatccgcaggcctcgctggcggcgatcgagacgctgcgcgccggaggcaatgcc
gcggatgccgcgatcgcggccagcgcgctgctcgcggtgatcgagccgcaatccaccggc
atcggcggcgactgtttcgcgctgtatcagcccggtgggcaaggctcgatcgtctcctat
aacggctccggccgggcgccgcaggccgcgcacgccgaatggttcgtcgagcaaggcatc
aacgccattccgctgaccagcccgcacgcggtgacgattcccggcgcgatcgacgcctgg
gcgacgatcttgcgcgatcacggccggttcgggctcgacaccctgttgcagccggcgatc
aaggccgccgacgacggctatgtggtggcgccgcgcatcgccttcgactgggccaacggc
tttgccaagctgaagaagggcgtcaacaccgcgcgctatctgctgccgcgcggtgaggcc
gcggtgaccggcgacgtgatccggcagccggaattggccgagacgctgcggctgatcgcc
aagctcggcccagacggtttttacaagggcgcggtcgccgaagacatggtggcgacgctg
cgcgggctcggcgggctgcatacgctggaagatttcgcgacccacgcgaccgagaccacc
acgccgatcagcaccagctacaagggccacgacgtctggcagtgcccgccgaacggcccc
ggcatcaccatgctggtgatgctcaacgtgctcagcctgttcgatctcagcaaatacgcc
ccgctcagcgtcgagcgttttcatctcgaagctgaagcggcgcggatcgcctatctgatg
cgcgaacagcacatcggcgatcccggccatgtcgacgtcgacgtgatccggattctgtcg
cgcgaattcgccgccgaatatggcagccagattaagatggaccggctgctcgatctgccg
aaggtctcgccgccgatgaatccgtcgacggtgtacatcaccgtggtcgatcaggatcgc
aacgtctgctcgttcatcaattcgatcgcgcattcgttcggctcggcgatcatctcggaa
aagaccggcgtgctgctgcagaaccgcggcgccggcttccgcgtgcagcccggccatccg
aactgcatcgcgcccggcaagcggccgctgcacaccatcattccgagtctggccaccgaa
aacggccgcgccaaattgtcgttcggcgtgatgggcggacagtatcagccggtcggccag
gtccacgtgctgaccaacatgctcgacttcgggctcgacatgcagcaggcgatcgacctg
ccgcgcgggctgcattacgagggcgtctatcagttggaagacggcgtgccggccgatgtc
gtcgatggcctgcgcaagatcggccacgacatcgccgggctgtcggtgccgcacggcggc
ggccagggcgtctggatcgattgggagaaaggcacgctcaccggcggctccgatccgcgc
aaggacggctgcgcgctgggctattga

DBGET integrated database retrieval system