KEGG   Rhodopseudomonas palustris BisB18: RPC_1431Help
Entry
RPC_1431          CDS       T00336                                 

Definition
(GenBank) ADP-glyceromanno-heptose 6-epimerase precursor
  KO
K03274  ADP-L-glycero-D-manno-heptose 6-epimerase [EC:5.1.3.20]
Organism
rpc  Rhodopseudomonas palustris BisB18
Pathway
rpc00540  Lipopolysaccharide biosynthesis
rpc01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:rpc00001]
 09100 Metabolism
  09107 Glycan biosynthesis and metabolism
   00540 Lipopolysaccharide biosynthesis
    RPC_1431
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01005 Lipopolysaccharide biosynthesis proteins [BR:rpc01005]
    RPC_1431
Enzymes [BR:rpc01000]
 5. Isomerases
  5.1  Racemases and epimerases
   5.1.3  Acting on carbohydrates and derivatives
    5.1.3.20  ADP-glyceromanno-heptose 6-epimerase
     RPC_1431
Lipopolysaccharide biosynthesis proteins [BR:rpc01005]
 Unusual sugar
  RPC_1431
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Epimerase GDP_Man_Dehyd 3Beta_HSD RmlD_sub_bind Polysacc_synt_2 NAD_binding_4
Motif
Other DBs
NCBI-ProteinID: ABD86993
UniProt: Q219E3
Position
1554978..1555958
Genome map
AA seq 326 aa AA seqDB search
MLLVTGGAGFIGSNVVAALNDAGRADVAVCDVLGHDGKWKNLAKRQLADVVPPGELMGWL
QGRRLDAIIHMGAISETTATDGDLVIETNFRLSMRLLDWCTANKVPLIYASSASTYGDGE
QGFKDDQSVAALKQLRPMNLYGWSKHLFDLAVAERAARGDQLPPQWAGLKFFNVFGPNEY
HKGSMMSVLAKRFDDVKSGRVVQLFKSHRAGIEDGDQRRDFIYVDDVVRVMTWLLATPSV
SGIFNVGTGHARSFRDLILSAYAALGAKPNIEYIDMPESIRGSYQYFTESEGERLRAAGY
NGGFTALEDAVAHYVKGFLDAEDRFR
NT seq 981 nt NT seq  +upstreamnt  +downstreamnt
atgctgctggtgaccggaggggccggttttatcgggtcgaacgtcgtggccgcgctgaac
gacgccggccgcgccgacgtcgcggtgtgcgacgtgctcggccacgacggcaaatggaag
aatctggccaagcgccagctcgcggatgtcgtgccgccgggcgagctgatgggctggctg
cagggccgcaggctcgacgccattatccacatgggcgcgatctcggagaccaccgcgacc
gacggcgacctggtgatcgagaccaatttccggctgtcgatgcggctgttggactggtgc
accgccaacaaggtgccgctgatctatgcctcgtcggcctcgacctatggcgatggcgag
cagggcttcaaggacgatcaatccgtcgccgcgttgaaacagctgcggccgatgaacctg
tatggctggagcaagcatctgttcgatcttgcggtcgccgaacgcgccgcgcgcggcgac
cagttgccgccgcaatgggccgggctgaagtttttcaacgtgttcggccccaacgaatat
cacaagggcagcatgatgagcgtgctggccaagcggttcgacgacgtcaaatccggccgc
gtggtgcagttgttcaagtcgcaccgcgccggcatcgaagacggcgaccagcgccgcgac
ttcatctatgtcgacgacgtggtgcgggtgatgacctggctgttggcgacgccgtcggtc
agcggcatcttcaacgtcggcaccgggcatgcccgcagcttccgcgacctgatcctgtcg
gcctatgcggcgctcggcgccaagccgaacatcgaatatatcgacatgccggaaagcatt
cgcggcagctaccaatacttcaccgagagcgaaggcgagcggttgcgcgccgccggctac
aatggcggcttcaccgcgctggaagacgcggtcgcgcactacgtcaaaggcttcctcgac
gccgaggaccgcttccggtga

DBGET integrated database retrieval system