KEGG   Rhodopseudomonas palustris BisB18: RPC_1570Help
Entry
RPC_1570          CDS       T00336                                 

Definition
(GenBank) glycine cleavage system T protein
  KO
K00605  aminomethyltransferase [EC:2.1.2.10]
Organism
rpc  Rhodopseudomonas palustris BisB18
Pathway
rpc00260  Glycine, serine and threonine metabolism
rpc00630  Glyoxylate and dicarboxylate metabolism
rpc00670  One carbon pool by folate
rpc01100  Metabolic pathways
rpc01110  Biosynthesis of secondary metabolites
rpc01130  Biosynthesis of antibiotics
rpc01200  Carbon metabolism
Brite
KEGG Orthology (KO) [BR:rpc00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00630 Glyoxylate and dicarboxylate metabolism
    RPC_1570
  09105 Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    RPC_1570
  09108 Metabolism of cofactors and vitamins
   00670 One carbon pool by folate
    RPC_1570
Enzymes [BR:rpc01000]
 2. Transferases
  2.1  Transferring one-carbon groups
   2.1.2  Hydroxymethyl-, formyl- and related transferases
    2.1.2.10  aminomethyltransferase
     RPC_1570
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: GCV_T GCV_T_C
Motif
Other DBs
NCBI-ProteinID: ABD87132
UniProt: Q218Q4
Position
complement(1702672..1703826)
Genome map
AA seq 384 aa AA seqDB search
MMLAQNDQTAPLQRTPLHALHLSLGGKMVPFAGYEMPVQYPTGVLKEHLHTRAKAGLFDV
SHMGQLELRAKSGHVADAARALERLVPQDILAIAPGRQRYAQFTNEQGGILDDLMVANSG
RHLFLVVNAACKAADEAHLRDGLSDVCDIVSRPDRALLALQGPHAEAALSRLCSQVDTLR
FMDTAPLTVMGLDCLVSRSGYTGEDGYEISVPADGAVALAEALLDDPEVLPIGLGARDSL
RLEAGLCLYGHDIDASTTPVEAALEWSIQKSRRNGGPRPGGFAGAAVILDQLETGAPRRR
VGLRPDGRAPVREGAPLFGDDSATDSIGTISSGGFGPSLGGPLAMGYLPTPQARHDAVIF
AELRGQRLPLRVCATPFIPTSYKR
NT seq 1155 nt NT seq  +upstreamnt  +downstreamnt
atgatgctggcacagaacgatcaaacggcccccctgcagcggaccccgctgcacgcgctg
cacctgtcgcttggcggcaagatggtaccgtttgcgggctacgagatgccggtgcaatac
cccaccggcgtgctcaaggagcatctccatacccgcgccaaggccgggctgttcgacgtc
tcgcacatgggacagctcgaactgcgggccaaatccggccatgtcgccgatgccgcgcgg
gcgctggaacggctggtgccgcaggatattctggcgatcgcaccggggcggcagcgctac
gcccagttcaccaatgagcaaggcggcattctcgacgacctgatggtggcgaattccggc
cgccatctgtttctggtggtgaacgccgcctgcaaggccgccgacgaggcgcatctgcgc
gatgggctgtccgacgtctgcgacatcgtctcccggcccgaccgggcgctgctggcgctg
caaggccctcacgccgaagccgcgctcagcaggctctgtagccaggtcgacacgttgcgc
ttcatggacaccgccccgctcaccgtgatggggttggactgcttggtgtcgcgctccggc
tacaccggcgaggacggctatgagatctcggtgccggccgacggcgccgtggcgctggcc
gaagcgctgctcgacgatcccgaggtgctgccgatcggacttggcgcccgcgacagcctg
cggctcgaggccgggctctgcctttacggtcacgacatcgacgccagcaccacgccggtc
gaagcggcgctggagtggtcaatccaaaaaagccgccgcaacggcggcccgcggccgggc
ggttttgccggcgccgcggtgattttggaccaattggaaaccggcgcgccgcgccgccgc
gtcggactgcggccggacggccgcgccccggtgcgcgagggcgcgccgctgttcggcgac
gacagcgccaccgattcgatcggcacgatcagctcgggcgggttcgggccgagcctcggc
ggcccgttggcgatgggttatctgccgacgccacaggctcgtcacgatgccgtgatcttt
gccgaactgcgtggccagcggctgccgctgcgggtctgcgccacccctttcattccgacc
agctacaagcgttaa

DBGET integrated database retrieval system