KEGG   Rhodopseudomonas palustris BisB18: RPC_2005Help
Entry
RPC_2005          CDS       T00336                                 

Definition
(GenBank) acetyl-CoA acetyltransferase
  KO
K00626  acetyl-CoA C-acetyltransferase [EC:2.3.1.9]
Organism
rpc  Rhodopseudomonas palustris BisB18
Pathway
rpc00071  Fatty acid degradation
rpc00072  Synthesis and degradation of ketone bodies
rpc00280  Valine, leucine and isoleucine degradation
rpc00310  Lysine degradation
rpc00362  Benzoate degradation
rpc00380  Tryptophan metabolism
rpc00620  Pyruvate metabolism
rpc00630  Glyoxylate and dicarboxylate metabolism
rpc00640  Propanoate metabolism
rpc00650  Butanoate metabolism
rpc00900  Terpenoid backbone biosynthesis
rpc01100  Metabolic pathways
rpc01110  Biosynthesis of secondary metabolites
rpc01120  Microbial metabolism in diverse environments
rpc01130  Biosynthesis of antibiotics
rpc01200  Carbon metabolism
rpc01212  Fatty acid metabolism
rpc02020  Two-component system
Brite
KEGG Orthology (KO) [BR:rpc00001]
 Metabolism
  Carbohydrate metabolism
   00620 Pyruvate metabolism
    RPC_2005
   00630 Glyoxylate and dicarboxylate metabolism
    RPC_2005
   00640 Propanoate metabolism
    RPC_2005
   00650 Butanoate metabolism
    RPC_2005
  Lipid metabolism
   00071 Fatty acid degradation
    RPC_2005
   00072 Synthesis and degradation of ketone bodies
    RPC_2005
  Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    RPC_2005
   00310 Lysine degradation
    RPC_2005
   00380 Tryptophan metabolism
    RPC_2005
  Metabolism of terpenoids and polyketides
   00900 Terpenoid backbone biosynthesis
    RPC_2005
  Xenobiotics biodegradation and metabolism
   00362 Benzoate degradation
    RPC_2005
 Environmental Information Processing
  Signal transduction
   02020 Two-component system
    RPC_2005
Enzymes [BR:rpc01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.9  acetyl-CoA C-acetyltransferase
     RPC_2005
Exosome [BR:rpc04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   RPC_2005
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Thiolase_N Thiolase_C ketoacyl-synt ACP_syn_III_C
Motif
Other DBs
NCBI-ProteinID: ABD87561
UniProt: Q216X5
Position
2180681..2181853
Genome map
AA seq 390 aa AA seqDB search
MSNIVIAAAARTAVGSFNGSLASIPAHDLGAAVIREVLLRANTEPADVSEVILGHVLTAG
QGQNPARQAAIAAGIPAESSAFCINQVCGSGLRSVALGAQAIQAGDAEIMVVGGQESMSL
SPHFVQLRGGIKMGNAELQDTMIKDGLWEAFNNYHMGTTAENVARAFNLTREAQDAFALK
SQQKAAAAQQGGRFRDELVAITVKTRKGDVVVDSDEHPKPGTTAETLAKLRPAFAKDGTV
TAGNASGLNDGAAALVLMREQDAVRRGLVPLARIASWATAGVDPAIMGTGPIPASRLALR
KAGWSVDALDLIEANEAFAAQALAVNKEMGWDPERVNVNGGAIALGHPIGASGARILVTL
LHEMQKRDAKKGLATLCIGGGMGVALCVER
NT seq 1173 nt NT seq  +upstreamnt  +downstreamnt
atgagtaacatcgtcatcgccgctgccgcccgcaccgcggtcggatccttcaacggcagc
ctcgccagcattcccgcccacgatctcggcgccgccgtgatccgcgaggtgctgcttcgc
gccaacaccgaaccggccgacgtgagcgaggtcatcctcggccacgtgctcaccgcgggg
caggggcagaacccggcgcgacaggcggcgatcgccgccgggattcccgccgaatccagc
gcgttctgcatcaaccaggtctgcggctccgggttgcgcagcgtcgcgctcggcgcccag
gccatccaggccggcgacgccgagatcatggtggtcggcggtcaggaaagcatgagcctg
tcgccgcatttcgtgcagctgcgcggcggcatcaagatgggcaacgccgaactgcaagac
accatgatcaaggacgggttgtgggaggccttcaacaactatcacatgggcaccaccgca
gagaacgtcgcgcgggcgtttaacctcacccgcgaggcgcaggacgcgttcgccttgaag
tcgcagcagaaggcggccgccgcccagcagggcggccggttccgcgatgaactggttgcc
atcaccgtcaagacccgcaagggcgacgtggtggtcgacagcgacgaacatccgaagcct
ggtaccacggcggagaccctggccaagttgcgcccggctttcgccaaggacggcacggtg
accgccggcaacgcctccggtctcaatgacggcgccgccgcgctggtgctgatgcgggaa
caggatgcggtgcgtcgcggtctggtgccgctggctcgcatcgcgtcctgggccacggcc
ggcgtcgatcccgccatcatgggcaccggcccgatcccggccagccgcctcgcgctgcgc
aaggccggctggagcgtcgatgcgctggatctcatcgaagccaacgaggccttcgccgcg
caggcgctggcggtgaacaaggagatgggctgggatccggagcgggtcaacgtcaatggc
ggggcgatcgcgctcggccatccgatcggcgcatccggcgcccgcatcctggtcacgctg
ctgcacgaaatgcaaaagcgcgatgccaagaaggggcttgccacgctttgcatcggcggc
ggcatgggcgtcgcgctctgcgtcgaacgctag

DBGET integrated database retrieval system