KEGG   Rhodopseudomonas palustris BisB18: RPC_2705Help
Entry
RPC_2705          CDS       T00336                                 

Definition
(GenBank) methionyl-tRNA synthetase
  KO
K01874  methionyl-tRNA synthetase [EC:6.1.1.10]
Organism
rpc  Rhodopseudomonas palustris BisB18
Pathway
rpc00450  Selenocompound metabolism
rpc00970  Aminoacyl-tRNA biosynthesis
rpc01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:rpc00001]
 09100 Metabolism
  09106 Metabolism of other amino acids
   00450 Selenocompound metabolism
    RPC_2705
 09120 Genetic Information Processing
  09122 Translation
   00970 Aminoacyl-tRNA biosynthesis
    RPC_2705
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01007 Amino acid related enzymes [BR:rpc01007]
    RPC_2705
  09182 Protein families: genetic information processing
   03016 Transfer RNA biogenesis [BR:rpc03016]
    RPC_2705
Enzymes [BR:rpc01000]
 6. Ligases
  6.1  Forming carbon-oxygen bonds
   6.1.1  Ligases forming aminoacyl-tRNA and related compounds
    6.1.1.10  methionine---tRNA ligase
     RPC_2705
Amino acid related enzymes [BR:rpc01007]
 Aminoacyl-tRNA synthetase
  Class I (U)
   RPC_2705
Transfer RNA biogenesis [BR:rpc03016]
 Eukaryotic type
  Aminoacyl-tRNA synthetases (AARSs)
   Multi-aminoacyl-tRNA synthetase complex (MSC)
    RPC_2705
 Prokaryotic type
   Other AARSs
    RPC_2705
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: tRNA-synt_1g tRNA-synt_1 tRNA-synt_1e Anticodon_1 tRNA-synt_1f tRNA-synt_1c
Motif
Other DBs
NCBI-ProteinID: ABD88254
UniProt: Q214D2
Position
2932479..2934047
Genome map
AA seq 522 aa AA seqDB search
MASASASARPAYFLSTPIFYPNGVPHIGHAYTAMVSDAIARFQRLDGYDVRFLTGTDEHG
LKMQQTAIAEGLTPLQLADRNSARFRDMMAALNISYDDYIRTTEPRHERSCQALWTAIEN
NGDIYLDKYAGWYSVRQEAYFDEAETTVGEDGVRREPLGSPVEWTEEETYFFRLSAYQDK
LLELYAKVPDFVLPRERLNEVASFVKGGLQDLSISRTTFDWGIKVPGAPRHVMYVWIDAL
TNYITGAGYPDVDSDSFKRYWPASLHVIGKDIVRFHAVYWPAFLMSAGVAVPQRVFSHGF
LLNRGEKMSKSVGNVVDPFEMAKQYGVDQMRYFFMREVSFGQDGSYNHEAIVNRTNADLA
NDLGNLAQRSLTMIGKQLGGVLPEPGDFSDNDKAILAQADAMIELARTAMATQQIHHMLN
AVWAVVAEANRYFAGEAPWALAKTDPARQKTVLYVTAEVLRQVAILAQPVMPASAAKLLD
SLGIAEEERDFTHLGGHERIRPGTPLPAPAPIFPRYVEPTPS
NT seq 1569 nt NT seq  +upstreamnt  +downstreamnt
atggcgtccgcatccgcttcagcccgtccggcctatttcctctccacgccgatcttctat
ccgaacggcgtgccgcatatcggccacgcctatacggcgatggtcagcgacgcgatcgcc
cggtttcagcggctcgacggctatgacgtccgcttcctgaccggcaccgacgagcacggc
ctgaagatgcagcagaccgcgatcgccgaagggctgacgccgctgcagctcgccgaccgc
aattcggcccggttccgcgacatgatggcggcgctgaacatctcctacgacgactacatc
cgcaccacggagccgcgccacgagcgctcctgccaggcgctgtggaccgcgattgaaaac
aacggcgatatctatctcgacaaatatgccggctggtactcggtgcgccaggaagcctat
ttcgacgaggccgagaccacggtcggcgaggacggcgtgcgccgcgagccgctcggctcg
ccggtggaatggaccgaggaggagacctacttcttccggctctcggcctatcaggacaaa
ttgctcgagctctacgccaaggtgccggacttcgtgctgccgcgcgaacggctcaacgag
gtggcgagtttcgtcaagggcgggctgcaggacctgtcgatctcgcgcaccacgtttgat
tggggcatcaaggtgccgggcgcgccgcgccatgtgatgtatgtctggatcgacgcgctc
accaactacatcaccggcgccggctatccggacgtcgacagcgacagcttcaagcgctac
tggccggccagcctgcacgtcatcggcaaggacatcgtgcggtttcatgcggtgtattgg
ccggcgttcctgatgtcggccggcgtcgcggtgccgcagcgggtgttcagccacggcttt
ctgctcaaccgcggtgagaagatgtcgaagtcggtcggcaacgtggtcgaccctttcgag
atggccaagcaatacggcgtcgaccagatgcgctacttcttcatgcgcgaggtgtcgttc
ggccaggacggcagctacaatcacgaggcgatcgtcaaccgcaccaatgccgacctcgcc
aacgacctcggcaatctggcgcagcgctcgctgaccatgatcggcaagcagctcggcggc
gtgctgccggagccgggcgatttcagcgacaatgacaaggcgatcctggcgcaggccgac
gcgatgattgagctcgcccgcacggcgatggcgacccagcagatccatcacatgctgaat
gcggtgtgggcggtggtcgccgaagccaaccgttacttcgccggcgaagcgccgtgggcg
ctggccaagaccgatcctgcgcggcagaagaccgtgctctacgtcaccgccgaagtgctg
cggcaggtcgcgattttggcgcagccggtgatgcccgcgtccgccgcgaagctgctcgac
agcctcggcattgccgaggaggagcgcgacttcacccatctcggcggccacgagcggatc
cggccgggcacgccgctgccggcgccggcgccgatctttccgcgctacgtcgagccgacg
ccttcgtga

DBGET integrated database retrieval system