KEGG   Rhodopseudomonas palustris BisB18: RPC_2929Help
Entry
RPC_2929          CDS       T00336                                 

Definition
(GenBank) arginase
  KO
K01476  arginase [EC:3.5.3.1]
Organism
rpc  Rhodopseudomonas palustris BisB18
Pathway
rpc00220  Arginine biosynthesis
rpc00330  Arginine and proline metabolism
rpc01100  Metabolic pathways
rpc01110  Biosynthesis of secondary metabolites
rpc01130  Biosynthesis of antibiotics
rpc01230  Biosynthesis of amino acids
Module
rpc_M00134  Polyamine biosynthesis, arginine => ornithine => putrescine
Brite
KEGG Orthology (KO) [BR:rpc00001]
 Metabolism
  Amino acid metabolism
   00220 Arginine biosynthesis
    RPC_2929
   00330 Arginine and proline metabolism
    RPC_2929
Enzymes [BR:rpc01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.3  In linear amidines
    3.5.3.1  arginase
     RPC_2929
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Arginase
Motif
Other DBs
NCBI-ProteinID: ABD88475
UniProt: Q213G1
Position
complement(3205792..3206772)
Genome map
AA seq 326 aa AA seqDB search
MNESAHCGAPKRLAVLGAAVDLGASQPGTLMGPAALRTAGLLPLLTALGFVVEDHGDLLP
TPPIDDADEALPANARQYRQIQGWVRALSARAYTLAQSGAIPIFLGGDHTLSMGSVNGVA
RHWQQQGRELFLLWLDAHADYNTPATTITGNMHGMSAGFLCGESGLDRLLGDEPRASLDP
GRLELFGIRSIDRLEKQLVQSRRISIADMRRIDEFGVGVLMRSFIERVQARNGVLHVSFD
VDFLDPELAPGVGTTVPGGATYREAHLVMELLHDAGLVRSVDIVELNPFLDVRGQTARTA
IELIGSLFGQQITDRPTPSNAVSREF
NT seq 981 nt NT seq  +upstreamnt  +downstreamnt
gtgaacgaatctgctcattgcggagcgccgaagcgcctggcggtgctgggcgcagcggtt
gacctcggcgcctcgcagcccggcaccctgatggggccggcggcgttgcgcaccgcggga
ctgctgccattgctgacggcgttgggcttcgtggtcgaggaccacggcgatcttttgccg
acgccgccgatcgacgacgctgacgaggcgttgcccgccaacgcccggcaatatcgccag
atccagggctgggtccgcgcgctcagcgcgcgcgcctacacgctggcgcaatccggcgcg
atcccgatctttctcggcggcgaccacacgctgtcgatgggctcggtcaacggcgtcgct
cgccactggcagcagcagggccgcgagctgttcctgctctggctcgacgcccatgccgac
tacaacaccccggccaccaccatcaccggcaacatgcacggcatgtcggcggggttcctc
tgcggcgaaagcgggctcgaccggctgctcggcgacgagccgcgggcgtcgctcgatccc
ggccggctcgaactgttcggcatccgctcgatcgaccggctggaaaagcaattggtgcag
agccgccgcatcagcatcgccgacatgcggcggatcgacgagttcggggtcggggtgttg
atgcgcagcttcatcgagcgggtgcaggcgcgcaacggcgtgctgcacgtctcgttcgac
gtcgattttctcgatccggagctggcgcccggcgtcggcaccacggtgccgggcggcgcc
acctatcgcgaagcccatctggtgatggagctgttgcacgacgccgggctggtgcgctcg
gtcgacatcgtcgagctcaatccgtttctcgacgtgcgcggccaaaccgcgcgcaccgcg
atcgaactgatcggcagcctgttcggccagcagatcaccgaccggccgaccccgagcaac
gcggtgtcgcgcgagttctga

DBGET integrated database retrieval system