KEGG   Rhodopseudomonas palustris BisB18: RPC_3100Help
Entry
RPC_3100          CDS       T00336                                 

Definition
(GenBank) Thiolase
  KO
K00626  acetyl-CoA C-acetyltransferase [EC:2.3.1.9]
Organism
rpc  Rhodopseudomonas palustris BisB18
Pathway
rpc00071  Fatty acid degradation
rpc00072  Synthesis and degradation of ketone bodies
rpc00280  Valine, leucine and isoleucine degradation
rpc00310  Lysine degradation
rpc00362  Benzoate degradation
rpc00380  Tryptophan metabolism
rpc00620  Pyruvate metabolism
rpc00630  Glyoxylate and dicarboxylate metabolism
rpc00640  Propanoate metabolism
rpc00650  Butanoate metabolism
rpc00900  Terpenoid backbone biosynthesis
rpc01100  Metabolic pathways
rpc01110  Biosynthesis of secondary metabolites
rpc01120  Microbial metabolism in diverse environments
rpc01130  Biosynthesis of antibiotics
rpc01200  Carbon metabolism
rpc01212  Fatty acid metabolism
rpc02020  Two-component system
Brite
KEGG Orthology (KO) [BR:rpc00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00620 Pyruvate metabolism
    RPC_3100
   00630 Glyoxylate and dicarboxylate metabolism
    RPC_3100
   00640 Propanoate metabolism
    RPC_3100
   00650 Butanoate metabolism
    RPC_3100
  09103 Lipid metabolism
   00071 Fatty acid degradation
    RPC_3100
   00072 Synthesis and degradation of ketone bodies
    RPC_3100
  09105 Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    RPC_3100
   00310 Lysine degradation
    RPC_3100
   00380 Tryptophan metabolism
    RPC_3100
  09109 Metabolism of terpenoids and polyketides
   00900 Terpenoid backbone biosynthesis
    RPC_3100
  09111 Xenobiotics biodegradation and metabolism
   00362 Benzoate degradation
    RPC_3100
 09130 Environmental Information Processing
  09132 Signal transduction
   02020 Two-component system
    RPC_3100
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:rpc04147]
    RPC_3100
Enzymes [BR:rpc01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.9  acetyl-CoA C-acetyltransferase
     RPC_3100
Exosome [BR:rpc04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   RPC_3100
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Thiolase_N Thiolase_C ACP_syn_III ketoacyl-synt
Motif
Other DBs
NCBI-ProteinID: ABD88642
UniProt: Q212P4
Position
complement(3442733..3443899)
Genome map
AA seq 388 aa AA seqDB search
MTASIVGWAHTPFGKLEAETVESLIVRVAADALADAGIAAADVDEIILGHFNAGFSPQDF
TAALVLQADPELRFKPATRVENACATGSAAVHQAVKSVAAGAKIVLVVGVEQMTKTPGPE
IGKNLLRASYLIEDGDTPAGFAGVFGNIAQKYFQKYGDQSDALAMIAAKNHHNGVSNPYA
QMRKDIGFDFCRAEGDKNPFVAGPLKRTDCSLVSDGAAALVITDADTAKAMSKAVTIKAT
AHAQDFLPMSKRDILRFEGCSVAWQRALQSAGATLQDLSFVETHDCFTIAELIEYEAMGL
TPAGQGARAIKEGWTRKDGKLPINPSGGLKAKGHPIGATGVSMHVLCAMQLLGQAPEGMQ
IKDAKLAGIFNMGGAAVANYVSLLEPAR
NT seq 1167 nt NT seq  +upstreamnt  +downstreamnt
atgacagccagcatcgtcgggtgggcgcacacgccgttcggcaagctcgaagccgagacc
gtcgagagcctgatcgtgcgggtggcggccgacgccttggcggacgccggcatcgccgcc
gccgacgtcgacgagatcatcctcgggcatttcaacgccgggttctcgccgcaggatttt
accgccgccttggtgctgcaggccgaccccgagctgcggttcaaaccggcgacccgggtt
gagaacgcctgcgccaccggatcggccgcggtgcaccaggcggtgaagtcggtcgccgcc
ggcgccaagatcgtcttggtggtcggcgtcgagcagatgaccaagaccccggggccggag
atcggcaagaacttgctgcgcgcctcctatctgatcgaggacggcgacaccccggcgggc
ttcgccggcgtgttcggcaacatcgcgcagaagtactttcagaaatacggcgaccagtcc
gacgcgctggcgatgatcgcggcgaagaaccaccataacggcgtatcgaatccctatgcg
cagatgcgcaaggacatcggcttcgacttctgccgcgctgagggcgacaagaacccgttc
gtcgccggccccctgaaacgcaccgactgctcgttggtgtcggacggcgctgcggccttg
gtgatcaccgacgccgacaccgccaaggcgatgtccaaggcggtgacgatcaaagccacg
gcgcacgctcaggatttcctgccgatgtcgaagcgcgacattctgcggttcgagggctgc
agcgtggcctggcagcgcgcgctgcaatccgccggcgcgaccctgcaggatctgtccttc
gtcgagacccacgattgcttcaccatcgccgaactgatcgaatacgaggcgatgggcctg
acgccggccgggcagggcgcccgcgccatcaaggaaggttggacccgcaaggacggcaag
ctgccgatcaatccgtccggtggcctcaaggccaaaggccatccgatcggcgccaccggg
gtgtcgatgcacgtgctctgtgcgatgcagctgctcggccaggcgccggagggcatgcag
atcaaggacgccaagctcgccggcattttcaatatgggcggcgccgcggtcgccaactac
gtctcgctgctcgagccggcgcgctga

DBGET integrated database retrieval system