KEGG   Rhodopseudomonas palustris BisB18: RPC_3540Help
Entry
RPC_3540          CDS       T00336                                 

Definition
(GenBank) Conjugal transfer protein TrbC
  KO
K20528  type IV secretion system protein TrbC
Organism
rpc  Rhodopseudomonas palustris BisB18
Pathway
rpc02024  Quorum sensing
Brite
KEGG Orthology (KO) [BR:rpc00001]
 09140 Cellular Processes
  09145 Cellular community - prokaryotes
   02024 Quorum sensing
    RPC_3540
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02044 Secretion system [BR:rpc02044]
    RPC_3540
Secretion system [BR:rpc02044]
 Type IV secretion system
  Trb secretion system protein
   RPC_3540
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: TrbC Rz1
Motif
Other DBs
NCBI-ProteinID: ABD89079
UniProt: Q210V7
Position
complement(3933424..3933768)
Genome map
AA seq 114 aa AA seqDB search
MIHRPHPLRRAIATPAGFTTLTTVLASLTAAPAWAAGSSMPWEQPLNQILQSVEGPVAKI
MAVIIIIVTGLTLAFGDTSGGFRRLIQIVFGLSIAFAASSFFLSFFSFGGGALV
NT seq 345 nt NT seq  +upstreamnt  +downstreamnt
atgatccatcgtccgcacccacttcgccgcgccatcgccacgcccgccggctttacaacc
ctgaccacggtcctggcttcgttgaccgctgcaccggcttgggcggccggctccagcatg
ccgtgggagcaaccgctcaaccagatcctgcaatcggtcgaaggcccggtcgccaagatc
atggcggtgatcatcatcatcgtcaccggcctgacattggcgttcggcgatacctcgggt
ggatttcgccgactgatccagatcgtgttcggtctctcgattgcgttcgcggcaagctcc
ttcttcctctcgttcttctccttcggcggcggagcgctggtctga

DBGET integrated database retrieval system