KEGG   Rhodopseudomonas palustris BisB18: RPC_3898
Entry
RPC_3898          CDS       T00336                                 

Definition
(GenBank) ATPase
  KO
K20530  type IV secretion system protein TrbE [EC:7.4.2.8]
Organism
rpc  Rhodopseudomonas palustris BisB18
Pathway
rpc02024  Quorum sensing
Brite
KEGG Orthology (KO) [BR:rpc00001]
 09140 Cellular Processes
  09145 Cellular community - prokaryotes
   02024 Quorum sensing
    RPC_3898
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02044 Secretion system [BR:rpc02044]
    RPC_3898
Enzymes [BR:rpc01000]
 7. Translocases
  7.4  Catalysing the translocation of amino acids and peptides
   7.4.2  Linked to the hydrolysis of a nucleoside triphosphate
    7.4.2.8  protein-secreting ATPase
     RPC_3898
Secretion system [BR:rpc02044]
 Type IV secretion system
  Trb secretion system protein
   RPC_3898
SSDB
Motif
Pfam: P-loop_TraG CagE_TrbE_VirB AAA_22 AAA_10 ABC_tran TraG-D_C DUF853 AAA_29 TrwB_AAD_bind AAA_16 FtsK_SpoIIIE CbiA
Other DBs
NCBI-ProteinID: ABD89424
UniProt: Q20ZL2
Position
complement(4327881..4330322)
AA seq 813 aa
MMNLSEYRHSTTCLADFLPWAALVGQGVVLNKDGSFQRTATFRGPDLDSAVPAELVGITA
RLNNALRRLGSGWAVFVEAQRHPASKYPECHFPDAASALVDLERRAQFEEEGAHFESSYF
LTFLYLPPAADVARAERLLYEGRDRDEGTDAREILGGFVDRTDRVLQLVEGFMPESAWLD
DQDTLTYLHSTISTKRYRIRVPETPMYLDALLADQPLTGGLEPMLGNAHLRVLTIVGFPT
TTTPGILDELNALAFAYRWSTRAIMLDKTDATKLLTKIRRQWFAKRKSIAAILKEVMTNE
AATLVDTDAQNKAMDADAALQELGSDAIGQAFVTATVAVWDGDPRAADEKLRLVEKVIQG
RDFTCMAESVNAVEAWLGSLPGHAYANVRQPPVSTLNLAHMIPLSAVWAGPLRDDHFDAP
PLFFARTEGATPFRFSLHVGDVGHTLVVGPTGAGKSVLLALMALQFRRYAGSQVFAFDFG
GSIRAAALAMGGDWHDLGGALSDNATEPVALQPLALIDDAAERGWAAEWIGNILARETIR
ITPEAKEHLWSALSSLASAPAPERTLTGLSVLLQSQTLKRALQSYCLGGPYGRLLDAEAE
RLGEGAVQAFETEGLIGTSAAPAVLGYLFHRIERRLDGRPTLLIIDEGWLALDDEGFAGQ
LREWLKTLRKKNASVIFATQSLSDIDGSAIAPAIIESCPTRLFLPNERAIEPQITAIYRR
FGLNDRQIEILARATPKRDYYCQSRRGNRLFELGLGGVALALAAASSKADHTLIESVIAE
HGRDGFLAAWLTQRGAGWAVDFIPRLSTKEPSA
NT seq 2442 nt   +upstreamnt  +downstreamnt
atgatgaatctttcggagtatcggcactcgacgacatgcctcgccgactttctgccctgg
gccgcgttggtcggtcagggcgtggtgttgaacaaggacggatctttccagcgaaccgca
acgtttcgcgggccggacctggattccgccgtgccggccgaactggtcggtattacggca
cgcttgaacaatgccttgcgccggctggggtcgggatgggccgtgttcgtcgaggcgcag
cgccatcccgcgagcaaatatcccgagtgccattttccggatgctgcatcggctttagtt
gatctcgagcgccgcgctcagttcgaggaggagggcgcgcacttcgaatccagctacttc
ctgactttcctctatctgccgccggccgccgatgtcgcgcgcgccgagcgcttgctgtac
gaggggcgcgatcgcgacgaaggcaccgatgcacgcgagatattgggcggtttcgtcgat
cgcaccgaccgggtgcttcaactggtcgagggttttatgcccgagagcgcttggctcgat
gaccaggacaccctgacctatctgcattccacgatctcgaccaagcgctaccggatcagg
gttccggaaacgccgatgtatctcgatgcactgctggccgaccagccgctgaccggtggg
ttggagccgatgctcggcaatgcgcatctgcgggtgctgaccatcgtgggtttcccgacc
accaccactcccggcatcctcgacgaattgaatgcactggccttcgcctatcgctggtcg
acccgcgccatcatgctcgacaagaccgacgccacaaagctgttgacgaagattcggcgg
cagtggttcgccaagcgcaaatcgattgcggccatcctcaaggaggtgatgaccaacgag
gccgcgaccctggtcgataccgacgcccagaacaaggcgatggatgcggacgcggcgttg
caggaactcgggtccgacgcgatcgggcaggcctttgtcacagcaacggtcgcggtatgg
gacggcgacccgcgtgccgctgacgaaaagctccgccttgtagagaaagtaattcaaggc
cgcgacttcacctgcatggctgagagcgtcaacgccgtcgaagcctggctcggatcgctg
ccaggtcacgcctacgccaatgttcgccagccgccggtttcgacgctgaatctggcccac
atgattccgctctcggcggtatgggccggaccgctccgagacgatcattttgatgctccg
ccgctgttctttgcccgcaccgagggcgcgaccccgttccggttttcgctgcacgttggc
gatgttgggcatacgctggtcgtcggtccgaccggcgccggcaagagtgtgctgctggcg
ctgatggcgctgcagttccggcgttacgccggttcacaggtgttcgctttcgatttcggc
ggctcgatccgggccgccgcgctcgcgatgggcggcgattggcacgatctcggtggcgcg
ctctccgacaatgcgaccgaaccggtcgcgctgcagccgctggctctgatcgatgacgcc
gcggagcgcggatgggcggcggaatggatcggcaacattttggcgcgtgagaccatccgg
atcaccccggaagcgaaagagcatctgtggtcggcgctgtcgtcgctggcgtctgcgccg
gcaccggagcgcacgctgaccggcctgtcagtgctgctgcagtcgcagactctgaagcgc
gcgctgcaatcctattgcctcggcggtccctacggccggctgctcgatgccgaggctgaa
cggctgggtgagggcgcagtccaggccttcgagaccgaggggctgatcggcaccagcgcc
gcgcccgcggtgctcggctatctgtttcatcgcattgagcggcggctcgatggccggccg
accttgttgatcatcgacgaaggctggctcgcgcttgatgacgagggctttgccggccag
cttcgcgagtggctaaagacgctgcgcaagaagaacgcttcggtaatcttcgccacccaa
tcactatcggacatcgatggctcggcgatcgcaccggccatcatcgagagctgtccgaca
aggttgttcctgcccaacgagcgcgcgatcgaaccgcagatcaccgcgatctatcgccgc
ttcggcctgaacgaccgccagatcgagatcctggcccgggccacgccaaagcgcgattac
tactgccagtcgcggcgcggcaaccggctgttcgagcttggcctcggcggtgtcgcgctg
gctttggcggccgcgtcctcgaaggccgatcataccttgatcgagagcgtcatcgccgaa
catggccgtgacggcttcctcgccgcctggctgacccagcgcggcgccggctgggcggtc
gatttcatcccaaggctttccacaaaggagccgtcagcatga

DBGET integrated database retrieval system