KEGG   Rhodopseudomonas palustris BisB18: RPC_4481Help
Entry
RPC_4481          CDS       T00336                                 

Definition
(GenBank) iron-containing alcohol dehydrogenase
  KO
K04072  acetaldehyde dehydrogenase / alcohol dehydrogenase [EC:1.2.1.10 1.1.1.1]
Organism
rpc  Rhodopseudomonas palustris BisB18
Pathway
rpc00010  Glycolysis / Gluconeogenesis
rpc00071  Fatty acid degradation
rpc00350  Tyrosine metabolism
rpc00620  Pyruvate metabolism
rpc00625  Chloroalkane and chloroalkene degradation
rpc00626  Naphthalene degradation
rpc00650  Butanoate metabolism
rpc01100  Metabolic pathways
rpc01110  Biosynthesis of secondary metabolites
rpc01120  Microbial metabolism in diverse environments
rpc01130  Biosynthesis of antibiotics
rpc01220  Degradation of aromatic compounds
Brite
KEGG Orthology (KO) [BR:rpc00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    RPC_4481
   00620 Pyruvate metabolism
    RPC_4481
   00650 Butanoate metabolism
    RPC_4481
  Lipid metabolism
   00071 Fatty acid degradation
    RPC_4481
  Amino acid metabolism
   00350 Tyrosine metabolism
    RPC_4481
  Xenobiotics biodegradation and metabolism
   00625 Chloroalkane and chloroalkene degradation
    RPC_4481
   00626 Naphthalene degradation
    RPC_4481
Enzymes [BR:rpc01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.1  alcohol dehydrogenase
     RPC_4481
  1.2  Acting on the aldehyde or oxo group of donors
   1.2.1  With NAD+ or NADP+ as acceptor
    1.2.1.10  acetaldehyde dehydrogenase (acetylating)
     RPC_4481
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Fe-ADH Aldedh Fe-ADH_2
Motif
Other DBs
NCBI-ProteinID: ABD90004
UniProt: Q20XY2
Position
4986853..4989507
Genome map
AA seq 884 aa AA seqDB search
MTLSTPSDLDKLVARVKAAQLIFATYSQEQVDLIFRSAALAASDARISLAQMATAETGMG
VVEDKVIKNHFASEYIYNAYKDDKTCGIIEVNDEAGIMVVAEPIGLICGIVPTTNPTSTA
IFKALICLKTRNGIIFSPHPRAARSTNAAAKLVLDAAVAAGAPPDIIGWIEKPTLELSNA
LMHHPAVNLILATGGPAMVKAAYSSGKPAIGVGAGNTPVVIDETADIKRAVASILMSKTF
DNGVVCASEQSIIVVDEVYDAVRQRFATHGGYMLKPAELDAVRRVLLVNGNVNVDIVGQS
AARIAELAGISVPHDTKILIGEVELTHTSEPFAHEKLSPTLAMYRRADYTQAVAAAVELV
ALGGIGHTSALYTDQDLQPERVADFGTKMKTARILINTPSSHGGLGDLYNFSLAPSLTLG
CGSWGGNSISENVGPKHLINKKTVAKRAENMLWHKLPKSIYFRRGATSEALKDLAGKKRA
LVVTDGFLFSKGYTDDVIRLLKKNGMEVETFFQVEADPTLSIINKGVEIAHAFKPDVIVA
FGGGSPMDAAKLIWVLYEHPDVQFEDLALRFMDIRKRIYKFPKLGQKAELVAIPTTSGTG
SEVTPFAVVTDDASGIKYPIADYELTPSMAIVDANFVMHLPKSLTAFGGIDAVVHALEAY
VSIMASEFTDGQALQALKLLKENLPSAYVNGAKDPVARERVHSGATIAGIAFANAFLGVC
HSMAHKLGAAFHIPHGLSNALLICNVIRYNANDNPTKQTAFSQYDRPKSRHRYGEIAIAL
GLDGVNTAARIDRLLEWLEGLKRELDIPASIREAGVSEADFLAKVDNIAVEAFDDQCTGA
NPRFPLVSELKTILLDSYYGRAFSEAHEEDEVVTLSVATANAAE
NT seq 2655 nt NT seq  +upstreamnt  +downstreamnt
gtgaccttatctaccccgtccgacctcgacaaattggtagcgcgcgtcaaagccgcccaa
ttgatcttcgctacctattctcaggaacaggtggacctgattttccgcagcgccgctttg
gcggcctccgacgcccggatctcgctggcgcagatggccaccgcggaaaccggaatgggc
gtcgtcgaggacaaggtgatcaagaatcactttgcctccgaatacatctacaatgcctat
aaggacgataagacctgcggcatcatcgaagtaaacgacgaagccggcatcatggtcgtc
gccgagccgatcggactgatctgcggcatcgtgccgaccaccaacccgacctcgaccgcg
atctttaaggcgctgatctgcctgaagacccgcaacggtatcatcttcagcccgcatccg
cgtgccgcgcgctcgaccaacgccgccgccaagctggtgctggacgccgccgtcgccgcc
ggcgcgccgccggatatcatcggctggatcgaaaagccgacgctggaactgtccaacgcg
ctgatgcaccacccagccgtcaacttgatcctcgccaccggtggtcccgccatggtgaag
gccgcctattcttcaggcaaaccggcgatcggcgtcggtgccggcaacaccccggtagtg
atcgacgaaaccgcggatatcaagcgggcggtagcgtcgatcctgatgtcgaagactttc
gacaacggcgtggtctgcgcctcggagcaatcgatcatcgtcgtcgacgaagtgtacgac
gcggtgcgccagcgtttcgccacccatggcggctacatgctgaagcccgcggaattggac
gcggtgcgccgggtgttgctggtcaacggcaacgtcaatgtcgatatcgtcgggcaatcg
gccgcacgcatcgccgaactcgccggcatctcggtgccgcacgacaccaagatcctgatc
ggcgaggtcgaactcacccacacctcggaacccttcgcgcatgaaaagctgtcgccgacg
ctggcgatgtatcgtcgcgccgactacacgcaggcggtggcggcggcggtggagctggtg
gcgctgggcggcatcggccacacctcggcgttgtacaccgaccaggacctgcagccggag
cgcgtcgccgatttcggcaccaagatgaagaccgcgcggatcctgatcaacaccccgtcg
tcgcatggcggcctcggtgatctgtacaatttcagcctggcgccgtcgctgacgctgggc
tgcggatcgtggggcggcaattcgatctccgagaatgtcggacccaagcacctgatcaac
aagaaaaccgtcgcgaagcgagccgagaacatgctgtggcacaagctgccgaaatcgatc
tatttccgccgcggcgccaccagcgaggcgctgaaggatctcgccggcaagaagcgggcg
ctggtcgtcaccgacggcttcctgttcagcaagggctacaccgacgacgtcatccggctc
ttgaaaaagaacggcatggaggtcgaaaccttcttccaggttgaagccgatcccacgctg
tcgatcatcaacaagggcgtcgagatcgcacacgccttcaagcccgacgtgatcgtggcg
ttcggcggcggctcgccgatggatgccgccaagctgatctgggtgttgtacgagcacccc
gacgtgcaattcgaagatctggcgctgcgcttcatggacatccgcaagcggatctacaaa
ttccccaagctcggccagaaggcggagctggtggcgattcccaccacctcgggcaccggc
tccgaagtgaccccgttcgcggtggtgaccgacgacgcctccggcatcaagtacccgatc
gccgactacgaactgacccccagcatggcgatcgtcgatgccaacttcgtgatgcatctg
ccgaagtcgttgacggcgttcggcggcatcgacgcggtggtgcacgcgctggaagcctat
gtgtcgatcatggccagcgagttcaccgacggccaggcgctgcaggcgctgaagctgttg
aaagagaatctgccgtcggcctatgtcaacggcgccaaggatccggtggcgcgcgaacgg
gtgcatagcggcgccaccatcgccggcatcgcgtttgccaatgcgttcctcggcgtctgc
cactcgatggcgcacaagctgggtgccgcgttccacatcccgcatggcctgtccaacgcg
ctgttgatctgcaacgtgatccgctacaacgccaacgacaatccgaccaagcagaccgcg
ttctcgcaatacgaccggccgaagtcgcggcatcgctacggcgagatcgccatcgcgctg
gggctggacggcgtcaacaccgccgcccgcatcgatcggctgctggagtggctcgaagga
ttgaagcgcgaactcgacatcccggcgtcgatccgggaagccggcgtgtccgaggccgac
ttcctggccaaggtcgataacatcgcggtggaagcgttcgacgaccagtgcaccggcgcc
aacccgcgcttcccgctggtctcggaactgaagactatcctgctcgacagctattacggc
cgtgccttcagcgaggcgcacgaggaagacgaggtcgtgacattgtcggtggcgacggcg
aacgccgcggaatag

DBGET integrated database retrieval system