KEGG   Rhodopseudomonas palustris BisB5: RPD_0387Help
Entry
RPD_0387          CDS       T00345                                 

Definition
(GenBank) orotidine-5'-phosphate decarboxylase
  KO
K01591  orotidine-5'-phosphate decarboxylase [EC:4.1.1.23]
Organism
rpd  Rhodopseudomonas palustris BisB5
Pathway
rpd00240  Pyrimidine metabolism
rpd01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:rpd00001]
 09100 Metabolism
  09104 Nucleotide metabolism
   00240 Pyrimidine metabolism
    RPD_0387
Enzymes [BR:rpd01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.1  Carboxy-lyases
    4.1.1.23  orotidine-5'-phosphate decarboxylase
     RPD_0387
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: OMPdecase
Motif
Other DBs
NCBI-ProteinID: ABE37625
UniProt: Q13E64
Position
complement(453455..454162)
Genome map
AA seq 235 aa AA seqDB search
MAQADPADRDRLIVALDVPSVDAANAMIEKLGDSVGFYKIGYQLAYAGGLPLVEKLARAG
KKVFVDLKLHDIGNTVARGVESLNSLGATFLTVHAYPQTMKAAVAARGDSGLKILAVTVL
TSYDDSDLADAGYRFGVRDLVEARARQALAIGVDGLVCSPEEAANLRGIVGPDMALVTPG
IRPAGAAAGDQKRIMTPARAIAAGASHLVVGRPVMEAADPKQAAEAIVAEIAQAT
NT seq 708 nt NT seq  +upstreamnt  +downstreamnt
atggcgcaagccgaccctgccgatcgcgaccggctgatcgtcgcgctggacgtccccagc
gtcgacgccgcgaatgcgatgatcgaaaagctcggcgacagcgtcggcttctacaagatc
ggctatcaactcgcttatgcgggcggcctgccgctggtcgaaaagctcgcccgcgccggc
aagaaggtgttcgtcgacctcaagctgcacgacatcggcaacaccgtggcgcgtggcgtc
gagagcctgaattcgctcggcgcgaccttcctcaccgtgcacgcctatccgcagaccatg
aaggccgcggtcgcggcgcgtggcgattcgggactgaagattctcgctgtgaccgtgctg
acgtcctacgacgacagcgatctcgccgacgccggctatcggttcggggtgcgggacctc
gtcgaggcgcgggcgcggcaggcgctggcgatcggcgtcgatggcctggtgtgctcgccc
gaagaggcggccaatctgcgcggcatcgtcggcccggacatggcgttggtgacgccggga
attcggcccgccggggcggccgctggcgatcagaagcggatcatgactccggcgcgcgca
atcgcggctggcgccagtcatctggtggtcggtcgcccggtgatggaagcagcggacccg
aagcaggcggccgaggcgatcgtcgccgagatcgcgcaggcgacatag

DBGET integrated database retrieval system