KEGG   Rhodopseudomonas palustris BisB5: RPD_0664Help
Entry
RPD_0664          CDS       T00345                                 

Definition
(GenBank) potassium-transporting ATPase, C subunit
  KO
K01548  potassium-transporting ATPase KdpC subunit
Organism
rpd  Rhodopseudomonas palustris BisB5
Pathway
rpd02020  Two-component system
Brite
KEGG Orthology (KO) [BR:rpd00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   02020 Two-component system
    RPD_0664
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: KdpC
Motif
Other DBs
NCBI-ProteinID: ABE37902
UniProt: Q13DD7
Position
748667..749272
Genome map
AA seq 201 aa AA seqDB search
MLKEIRPALVVLVVLTVICGLAYPLAMTGIAGVLFPEQAAGSLIVKDGAVIGSALIGQEF
KDDKYFHGRPSATSAADPADPTKTVSSPYNAANSSGSNLGPTSKALNDRVKEDVDKLKAE
NPSAAVPVDLVTASGSGLDPEISPEAALFQVPRVARARGLSEDGVRKLVNAQTKGRFAGL
LGEPRVNVLALNLALDATTRK
NT seq 606 nt NT seq  +upstreamnt  +downstreamnt
atgttgaaagaaattcgccccgcactcgtcgttctcgtcgtgctgacggtcatctgcggt
cttgcctatccgctggccatgaccggtatcgccggggtgctgttcccggagcaggccgcc
ggaagcctgatcgtcaaggacggcgccgtgatcggttcggcgctgatcggccaggagttc
aaggacgacaagtacttccacggccgcccgtcggcgacctcggcggctgaccccgccgat
ccgaccaagacggtgtcatcgccctacaacgccgccaactccagcggctccaatctcggg
ccgaccagcaaggcgctgaacgaccgcgtcaaggaagacgtcgacaagctcaaggccgag
aacccctcggccgcggtgccggtcgatctggtcaccgcctcgggcagcggactcgacccc
gagatttcgccggaggccgctttgtttcaggtgccgcgcgtcgcccgtgcccgcggtctg
tctgaagacggcgtccgcaagctggtgaacgcgcagaccaagggccgcttcgccggcctg
ctcggtgagccccgcgtgaacgtgcttgcgctcaatctggcgctggatgcgaccaccagg
aagtag

DBGET integrated database retrieval system