KEGG   Rhodopseudomonas palustris BisB5: RPD_0807Help
Entry
RPD_0807          CDS       T00345                                 

Definition
(GenBank) 3-hydroxyacyl-CoA dehydrogenase, NAD-binding
  KO
K01782  3-hydroxyacyl-CoA dehydrogenase / enoyl-CoA hydratase / 3-hydroxybutyryl-CoA epimerase [EC:1.1.1.35 4.2.1.17 5.1.2.3]
Organism
rpd  Rhodopseudomonas palustris BisB5
Pathway
rpd00071  Fatty acid degradation
rpd00280  Valine, leucine and isoleucine degradation
rpd00281  Geraniol degradation
rpd00310  Lysine degradation
rpd00362  Benzoate degradation
rpd00380  Tryptophan metabolism
rpd00410  beta-Alanine metabolism
rpd00640  Propanoate metabolism
rpd00650  Butanoate metabolism
rpd00903  Limonene and pinene degradation
rpd00930  Caprolactam degradation
rpd01040  Biosynthesis of unsaturated fatty acids
rpd01100  Metabolic pathways
rpd01110  Biosynthesis of secondary metabolites
rpd01120  Microbial metabolism in diverse environments
rpd01130  Biosynthesis of antibiotics
rpd01200  Carbon metabolism
rpd01212  Fatty acid metabolism
Brite
KEGG Orthology (KO) [BR:rpd00001]
 Metabolism
  Carbohydrate metabolism
   00640 Propanoate metabolism
    RPD_0807
   00650 Butanoate metabolism
    RPD_0807
  Lipid metabolism
   00071 Fatty acid degradation
    RPD_0807
   01040 Biosynthesis of unsaturated fatty acids
    RPD_0807
  Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    RPD_0807
   00310 Lysine degradation
    RPD_0807
   00380 Tryptophan metabolism
    RPD_0807
  Metabolism of other amino acids
   00410 beta-Alanine metabolism
    RPD_0807
  Metabolism of terpenoids and polyketides
   00903 Limonene and pinene degradation
    RPD_0807
   00281 Geraniol degradation
    RPD_0807
  Xenobiotics biodegradation and metabolism
   00362 Benzoate degradation
    RPD_0807
   00930 Caprolactam degradation
    RPD_0807
Enzymes [BR:rpd01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.35  3-hydroxyacyl-CoA dehydrogenase
     RPD_0807
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.17  enoyl-CoA hydratase
     RPD_0807
 5. Isomerases
  5.1  Racemases and epimerases
   5.1.2  Acting on hydroxy acids and derivatives
    5.1.2.3  3-hydroxybutyryl-CoA epimerase
     RPD_0807
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 3HCDH_N ECH_1 ECH_2 3HCDH NAD_binding_2 UDPG_MGDP_dh_N FAD_binding_3 F420_oxidored DAO ApbA NAD_binding_8 GIDA Pyr_redox_2 2-Hacid_dh_C Pyr_redox Sacchrp_dh_NADP NAD_Gly3P_dh_N
Motif
Other DBs
NCBI-ProteinID: ABE38045
UniProt: Q13CZ4
Position
910168..912384
Genome map
AA seq 738 aa AA seqDB search
MSYSNFKIETDSDGIALVTWDLPGRSMNVLDTKTIEELGAIVEQTTKDAAVKGVVITSAK
EAFCAGADLSMLEGMNKTFAQIRKEKGEEAAQQMLFDESRKLSQILRGIETSGKPWVAAI
NGLALGGGFEVTLACHYRVAADNPKTRLGLPEIKVGLFPGGGGTQRIPRIVQPQDSLTIL
LKGDQIKLDKAKAWKLVDAVVPAADLIKAAKDWIKGGGKAVAPWDEKGFKLPGGPVFSKQ
GMMMFPAGNAIYRRETYDNYPAARAIMSCVYEGLQVPMDVALRIESRYFAQVVQTKEAAA
MIRSLFLSMQELNKGARRPQGVPPTKVKKLAIIGAGFMGASVGYVSAKAGIDVVLIDRDQ
ESADKGKAHCKSVIDGLIAKGRAKEADRDALLARITATPDFNAIKDCDLVIEAVFEDRKV
KADTYAKAQPLLKEGAIFASNTSTLPINSLAEEFKDQSKFIGIHFFSPVEKMMLVEVIMG
NNTGDVALATALDYTRQIGKTPIVVNDSRGFFANRCVLRFTAEGLEMLLEGVPPAMIETA
AKMAGMPVGPLSLADEVALDLIVKIMKATEVDLGEQAVDQAQKKLMIEMVEKQGRFGRKN
AKGFYDYPEKGKGQKALWSGIGALQPKQLDPDTIDVEELKQRFLVVQAVEAARTVEDNVI
VDPREADVGSILGFGFAPFTGGTLSYIDFMGTKEFVALCHKLEGKFGSRFTPPKLLEDMA
KTGDTFYHRFAPKKQAAA
NT seq 2217 nt NT seq  +upstreamnt  +downstreamnt
atgagctacagcaacttcaagatcgagaccgactccgacggcatcgcgctcgtgacctgg
gatcttcccgggcgctcgatgaacgtgctcgataccaagaccatcgaggaactcggtgcg
atcgtcgagcagaccaccaaggacgccgccgtcaagggcgtggtgatcacgtccgccaag
gaggcgttctgcgccggcgccgacctgtcgatgctggaaggcatgaacaagaccttcgcg
cagatccgaaaggagaagggcgaggaagccgcgcagcagatgctgttcgacgagagccgc
aagctgtcgcagatcctgcgcgggattgaaacctccgggaagccgtgggtcgcggcgatc
aacggcctcgcgctcggcggcggcttcgaggtgacgctggcctgccattatcgcgtggcc
gccgacaatccgaagacccggctcggcctgcccgagatcaaggtcggcctgttcccgggc
ggcggcggcacccagcggattccgcgcattgtgcagccgcaggattcgctgacgatcctg
ctcaagggcgatcagatcaagctcgacaaggccaaggcatggaagctggtcgacgccgtg
gtgccggctgcggacctgatcaaggccgcgaaggactggatcaagggcggcggcaaggcg
gtcgcgccgtgggacgagaagggcttcaagctgccgggcggcccggtgttctcgaagcag
ggcatgatgatgttcccggccggcaacgccatctatcgccgcgagacctacgataactat
ccggcagcgcgtgccatcatgagctgcgtctatgaaggcctgcaggtgccgatggacgtc
gcgctgcgcatcgagtcgcgctatttcgcgcaggtggtacagaccaaggaagcggcggcg
atgatccgcagcctgttcctgtcgatgcaggagctgaacaagggcgcgcgccgtccgcag
ggcgtgccgccgaccaaggtcaagaagctcgccatcatcggcgcaggcttcatgggcgcc
agcgtcggttacgtctcggccaaggccggcatcgacgtcgtgctgatcgatcgcgaccag
gagagcgccgacaagggcaaggcgcactgcaaatcggtgatcgacgggctgatcgccaag
ggtcgcgccaaggaagccgaccgcgacgcgctgctggcgcgcatcaccgcgacgccggac
ttcaacgcgatcaaggattgcgacctggtgatcgaggcggtgttcgaggatcgcaaggtc
aaggccgacacctacgccaaggcgcagccgctgctgaaggaaggcgcgatcttcgcctcc
aacacctcgacgctgccgatcaactcgctggccgaggagttcaaggaccagtcgaagttc
atcggcatccacttcttctcgccggtcgagaagatgatgttggtggaagtgatcatgggc
aacaacaccggtgacgtggcgctggcgaccgcgctcgactacacccgccagatcggcaag
accccgatcgtggtgaacgacagccgcggcttcttcgccaaccgctgcgtgctgcgcttc
accgccgagggcctggagatgctgctcgaaggcgtgccgccggcgatgatcgaaaccgcc
gccaagatggccggcatgccggtaggcccgctgtcgctcgccgacgaagtcgcgctcgat
ctgatcgtgaagatcatgaaggccaccgaagtcgacctcggcgaacaggcggtcgatcag
gcgcagaagaagctgatgatcgagatggtggagaagcagggccgcttcggccgcaagaac
gccaagggcttctacgactatccggagaagggcaagggccagaaggcgctgtggagcggc
atcggcgcgctgcagccgaagcagctcgatcccgacaccatcgacgtcgaggagctgaag
cagcgcttcctggtggtgcaggcggtggaagccgcgcgcacggtcgaggacaacgtcatc
gtcgatccgcgcgaagcggatgtcggctcgatcctcggcttcggcttcgcgccgttcacc
ggcggcacgctgagctacatcgacttcatgggcaccaaggagttcgtggcgctgtgccat
aagctcgaaggcaaattcggctcgcgcttcacgccgccgaagctcttggaagacatggcc
aagaccggcgacaccttctaccaccgcttcgccccgaagaagcaggcggcggcgtag

DBGET integrated database retrieval system