KEGG   Rhodopseudomonas palustris BisB5: RPD_0950Help
Entry
RPD_0950          CDS       T00345                                 

Definition
(GenBank) arginase
  KO
K01476  arginase [EC:3.5.3.1]
Organism
rpd  Rhodopseudomonas palustris BisB5
Pathway
rpd00220  Arginine biosynthesis
rpd00330  Arginine and proline metabolism
rpd01100  Metabolic pathways
rpd01110  Biosynthesis of secondary metabolites
rpd01130  Biosynthesis of antibiotics
rpd01230  Biosynthesis of amino acids
Module
rpd_M00134  Polyamine biosynthesis, arginine => ornithine => putrescine
Brite
KEGG Orthology (KO) [BR:rpd00001]
 Metabolism
  Amino acid metabolism
   00220 Arginine biosynthesis
    RPD_0950
   00330 Arginine and proline metabolism
    RPD_0950
Enzymes [BR:rpd01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.3  In linear amidines
    3.5.3.1  arginase
     RPD_0950
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Arginase
Motif
Other DBs
NCBI-ProteinID: ABE38188
UniProt: Q13CK1
Position
complement(1067544..1068530)
Genome map
AA seq 328 aa AA seqDB search
MTPSGSALPTDVPRRVALLGVPIEIGAGLRGTLMGPAALRTAGIGRLLEQLRIEVEDHGD
MTRPQRDRGNDPTPANANFYGEVRSWVGAISARAYELAQSGAVPLFMGGDHSLSMGSVNG
VARYWQTQGKPLFVLWLDAHADYNTPTTTLTANMHGMSAAFLCGEPGLDDLLGDAPRVPI
PASQLDLFGIRSIDPLEKELVRARAIPVVDMRAIDEFGVGVLIRRVIDRVRAAGGVLHLS
FDVDFLDPAVAPGVGTTVPGGATYREAHLIMELLHDSGLVRSLDVVELNPFLDERGRTAR
VAVELIGSLFGMQITDRQTPSNALLPGE
NT seq 987 nt NT seq  +upstreamnt  +downstreamnt
atgacgccgtccggttccgcgctcccgactgatgtcccgcgccgcgtcgcgctgctcggc
gtgccgatcgaaatcggcgccggactgcgcggcacgctgatgggccccgcggcgctgcgc
accgccggcatcggccggctgctggaacagcttcgcatcgaggtcgaggaccatggcgac
atgacccggcctcaacgcgaccgtggcaacgatccgacgccggccaacgccaatttctac
ggcgaggtgcggagttgggtcggcgcgatctcggcgcgggcctacgagctggcgcagtcc
ggcgcggtgccgctgttcatgggcggcgatcacagcctgtcgatgggctcggtcaacggc
gtcgcgcgctactggcagacgcaaggcaagccgctgttcgtgctgtggctcgacgcccat
gccgactacaacacgccaacgacgacgctgaccgccaacatgcacggcatgtcggcggcg
ttcctgtgcggcgagcccgggctcgacgatctgctcggcgacgcgccgcgggtgccgatc
cccgcaagccagctcgacctgttcggcatccgctcgatcgacccgctcgagaaggagctg
gtgcgcgcgcgggcgatcccggtggtcgatatgcgcgcgatcgacgaattcggcgtcggc
gtgctgatccgccgggtgatcgaccgcgtccgcgccgcgggcggcgtgctgcatctgtcg
ttcgacgtcgacttcctcgaccccgccgttgcgccgggcgtcggcaccacggtgccgggc
ggcgcgacctatcgggaggcgcatctgatcatggagctgctgcacgattccggcctggtg
cgctcgctcgacgtggtcgagctcaacccgttcctcgacgaacgcggccgcaccgcccgg
gtcgcggtggaattaatcggcagcctgttcggaatgcagatcaccgaccgccagaccccc
agcaacgcgctgctgccgggcgaatag

DBGET integrated database retrieval system