KEGG   Rhodopseudomonas palustris BisB5: RPD_1764Help
Entry
RPD_1764          CDS       T00345                                 

Definition
(GenBank) Threonine aldolase
  KO
K01620  threonine aldolase [EC:4.1.2.48]
Organism
rpd  Rhodopseudomonas palustris BisB5
Pathway
rpd00260  Glycine, serine and threonine metabolism
rpd01100  Metabolic pathways
rpd01110  Biosynthesis of secondary metabolites
rpd01120  Microbial metabolism in diverse environments
rpd01130  Biosynthesis of antibiotics
rpd01230  Biosynthesis of amino acids
Brite
KEGG Orthology (KO) [BR:rpd00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    RPD_1764
Enzymes [BR:rpd01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.2  Aldehyde-lyases
    4.1.2.48  low-specificity L-threonine aldolase
     RPD_1764
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Beta_elim_lyase Aminotran_1_2 Cys_Met_Meta_PP DegT_DnrJ_EryC1
Motif
Other DBs
NCBI-ProteinID: ABE39000
UniProt: Q13A89
Position
complement(1979859..1981025)
Genome map
AA seq 388 aa AA seqDB search
MRRVVAGTSRSIAERSANRTHSASRRRCANLPLMAYIPALPDSNAPPVRINLLSDTQTRP
SAAMREAMARAEVGDEQMGDDPTVNALNERVAALLGKQAAVFLPSGTMCNVTATLSTCRP
GDEIIAHRTAHILSREGGAHAAIGGFQITPLDGDDGQFSLDAFRAALHPRSRYQPPQTMV
SVEQTANIGGGTIWPQATLDAIAAAGKAAGLVTHMDGARLMNAVVATGITARDMAAGWDS
VWIDFSKGLGAPVGASLAGSRDFIDEVWRWKQRLGGSMRQAGVIAAACNYALDHHVERLA
EDHAHARALAAGLAQIAGVEVQEPQTNLVFFSPEGAGLGGEAMVAALRQRGVLLATMDGR
IRACTHLDVSRDMIDETIGLVREILRRQ
NT seq 1167 nt NT seq  +upstreamnt  +downstreamnt
atgcgacgcgtggtggccggcacaagtcgatcgatcgcagagcgctctgcaaatcgcacc
cattccgcttcacgccggcgctgtgctaatctgcccctcatggcctatatccctgctctg
ccggattccaacgcgccgccggtgcgcatcaatctcctctccgacacccagacgcgaccg
agcgcagcgatgcgggaggcgatggcgcgcgcggaggtcggcgacgaacaaatgggcgac
gatccgaccgtcaatgcgctgaacgagcgcgtcgcggcgctgctcggcaagcaagccgcg
gtgttcctgccgtcgggcacgatgtgcaacgtcaccgcgacgctcagcacctgtcgtccc
ggcgacgagatcatcgcgcatcgcaccgcgcatattctgtcgcgcgaaggcggcgcccat
gcggcgatcggcggcttccagatcacgccgctcgacggcgacgacggccagttctcgctc
gatgcgtttcgcgccgcgctgcatccgcgctcgcgctaccagccgccgcagacgatggtc
agcgtcgagcagaccgccaatatcggcggcggcacgatctggccgcaggcgacgctcgat
gcgatcgccgcggcaggcaaggcggccggactcgtcacccatatggacggcgcgcggctg
atgaacgccgtggtcgccaccggcatcaccgcccgcgacatggccgcgggctgggattcg
gtgtggatcgatttcagcaaagggctcggcgctccggtgggcgcgtcgctcgccggctca
cgcgacttcatcgacgaggtgtggcgctggaagcagcggctcggcggctcgatgcggcag
gccggcgtgatcgccgccgcctgcaactacgcgctagaccatcacgtcgaacggctcgcg
gaggatcacgcccatgcgcgggcgctggccgcgggactggcgcagatcgcgggcgtcgag
gtgcaggagccgcagaccaatctggtgttcttcagccccgaaggcgccggcctcggcggc
gaggccatggtcgcggcgctgcgccagcgcggcgtgctgctggcgacgatggacggccgg
atccgggcttgcacccatctcgacgtcagccgcgacatgatcgacgagacgatcggtctg
gtgcgcgagattctgcgtcgtcaataa

DBGET integrated database retrieval system