KEGG   Rhodopseudomonas palustris BisB5: RPD_1895Help
Entry
RPD_1895          CDS       T00345                                 

Definition
(GenBank) sodium/hydrogen exchanger
Organism
rpd  Rhodopseudomonas palustris BisB5
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Na_H_Exchanger TrkA_N
Motif
Other DBs
NCBI-ProteinID: ABE39130
UniProt: Q139V9
Position
complement(2127302..2129026)
Genome map
AA seq 574 aa AA seqDB search
MHELIRDITLCILFAWMLGLSAHFFRQPLILAYLIAGFAIGPFGLGLVRSQDSISVISEL
GLIFMLFMIGLEIDLKKVVRAGSVILVAAGGQLIGGCLLGLAFFFGIGLSIGGGQFDAVY
LTVACALSSTVIIVKVLYEKRELDTLPGRLTLGVLVLQDIFAILFLAVQPSLADLQVSVL
LLSIGRVAMLVATALVLSRYVLPWLFHRIARTPELVLLGALAWCFLIGEIAERLHLSREM
GSLVAGVSLSTFPYALDVTAKVTTLRDFFITLFFVAVGMTIPIPNGSVIMLALAIAAFTV
VSRVVTTFLPLYLMRQGLRASLLPALNLAQISEFSLVVIQTGIAAGHIRTETASAASFAF
VLLAVLSTFVMVRSDPITRRAIRLLKALGLRDLDHRAADPEDEASHGAVRRIVILGFFRA
ASALISEIERQNEELLKQISVIDFNPNVYRTLVARGMHVIYGDISSADTLLHAGVGKAEI
IILSVPDSLLKGATNERLVRHVRALNPTARIIATADLLADVATLYAAGANYVTVTRISDA
NELFSAIEAADNGLLDDKRVAFDARLAERREVLP
NT seq 1725 nt NT seq  +upstreamnt  +downstreamnt
atgcacgaactaattcgcgacatcacgctgtgcatcctgttcgcctggatgcttgggctg
tcggcgcattttttccgtcagccactgatcctcgcctaccttatcgccggctttgcgatc
ggtccattcggcctcggtctggtgcgatcgcaggactcgatctcggtgatctccgagctc
ggtttgatcttcatgctgttcatgatcggactcgagatcgacctgaagaaggtcgtccgc
gccggcagcgtgattctggtcgccgccggcggacagttgatcggcggatgcctgctcggc
ctcgcgttcttcttcggcatcggcctgtcgatcggcggcggacagttcgacgcggtctat
ctcaccgtcgcctgcgcgctgtcctccaccgtcatcatcgtcaaggtgctgtacgaaaag
cgcgagctcgacaccctgcccggccggctcacgctcggcgtgctggtgctgcaggacatc
ttcgcgatcctgttcctggcggtgcagccgagcctcgccgatctgcaggtcagcgtgctg
ctgctgtcgatcggccgcgtcgccatgctggttgccacggctctggtgctgagccgctac
gtgctgccctggctgttccaccgcatcgcgcgcacgccggagcttgtgctgctcggcgcg
ctggcgtggtgcttcctgatcggcgagatcgccgagcggctgcatctgtcgcgcgagatg
ggatcgctggtcgccggcgtgtcgctgtcgaccttcccctatgcgctcgacgtcaccgcc
aaggtgacgacactgcgggacttcttcatcacgctgttcttcgtcgcggtcggcatgacg
atcccgatcccgaacgggtcggtgatcatgctggcgctggcgatcgccgcctttacagtg
gtcagccgggtcgtcaccaccttcctgccgctgtatctgatgcgccaaggcctgcgcgcc
agtctgctgccggcgctgaacctggcgcagattagtgagttctcgctggtggtgatccag
accggcatcgccgccggccacatccgcaccgagaccgcgagcgccgcgtcgttcgccttc
gtgttgctggcggtgctgtcgaccttcgtcatggtgcgcagtgatccgatcacccgccgc
gcgatccgcttgctgaaggcgctcggcctgcgcgatctcgaccacagagcggccgatccc
gaggacgaggccagccacggcgcggtgcgtcggatcgtgatcctcggcttcttccgcgcc
gccagcgcgctgatcagcgagattgagcggcagaacgaggagctgttgaagcagatcagc
gtgatcgacttcaatccaaacgtctatcgcaccctcgtcgcgcgcggcatgcacgtcatc
tacggcgacatcagcagtgccgacacgttgctgcacgccggcgtcggaaaggccgagatc
atcatcctcagcgtgccggattcgctcttgaaaggcgcgaccaacgagcggctggtgcgc
cacgtccgggcgctcaatccgaccgcgcggatcatcgcaaccgcggatcttctggcggat
gtcgctacgctatacgcggccggcgcgaattacgtcacggtgacccggatcagcgacgca
aacgaattgttcagcgcgatcgaggccgccgataacggcctgctcgacgacaagcgggtc
gcgttcgacgcccgcctcgccgaacggcgcgaagtgttgccgtag

DBGET integrated database retrieval system