KEGG   Rhodopseudomonas palustris BisB5: RPD_2065Help
Entry
RPD_2065          CDS       T00345                                 

Definition
(GenBank) cysteinyl-tRNA synthetase
  KO
K01883  cysteinyl-tRNA synthetase [EC:6.1.1.16]
Organism
rpd  Rhodopseudomonas palustris BisB5
Pathway
rpd00970  Aminoacyl-tRNA biosynthesis
Brite
KEGG Orthology (KO) [BR:rpd00001]
 09120 Genetic Information Processing
  09122 Translation
   00970 Aminoacyl-tRNA biosynthesis
    RPD_2065
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01007 Amino acid related enzymes [BR:rpd01007]
    RPD_2065
  09182 Protein families: genetic information processing
   03016 Transfer RNA biogenesis [BR:rpd03016]
    RPD_2065
Enzymes [BR:rpd01000]
 6. Ligases
  6.1  Forming carbon-oxygen bonds
   6.1.1  Ligases forming aminoacyl-tRNA and related compounds
    6.1.1.16  cysteine---tRNA ligase
     RPD_2065
Amino acid related enzymes [BR:rpd01007]
 Aminoacyl-tRNA synthetase
  Class I (G)
   RPD_2065
Transfer RNA biogenesis [BR:rpd03016]
 Eukaryotic Type
  Aminoacyl-tRNA synthetases (AARSs)
   Other AARSs
    RPD_2065
 Prokaryotic Type
    RPD_2065
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: tRNA-synt_1e tRNA-synt_1f tRNA-synt_1g DALR_2 tRNA-synt_1
Motif
Other DBs
NCBI-ProteinID: ABE39300
UniProt: Q139D9
Position
2313085..2314476
Genome map
AA seq 463 aa AA seqDB search
MALRLYDTLTKEKRDFAPLDPSRVRMYVCGPTVYDFAHIGNARPVIVFDVLFRLLRHLYG
ENHVKYVRNITDVDDKINDRAARDYPGLPLNESIRKVTEQTERQFHDDVDALGCLRPTVE
PRATEHIGEMRTIIDRLVEGGFAYVADDHVLFSPGAMNAADSVLPRYGALANRSLDEMIA
GARVDVAPYKRDATDFVLWKPSKPGEPSWPSPAGIATQGRPGWHIECSAMSWKHLGETFD
IHGGGIDLVFPHHENEVAQSCCAFHTSRMAQTWMHNGFLQVEGEKMSKSLGNFVTIRELL
ATEKFGGRKWDGATLRLAMLKTHYRQPIDWTADALHEAEKAIFDWSDFTKDATPGSCDDV
IAALTDDLNTPKMIAELHALRRAGKADELCGAMELLGISPVVRGTVDLDATAKSLIDART
AARARKDFKESDRIRDELAAMGIAIKDGKDSDGKPVTTWEIAR
NT seq 1392 nt NT seq  +upstreamnt  +downstreamnt
atggcattgcgcctctacgatacgctgaccaaggagaagcgcgacttcgcgccgctcgat
ccctcgcgtgtgcggatgtatgtctgcggcccgacggtctacgacttcgcccatatcggc
aatgcgcggccggtgatcgtgttcgacgtgttgttccggctgctccggcatctctacggc
gagaaccacgtcaaatacgtccgcaacatcaccgacgtcgacgacaagatcaacgaccgc
gccgcgcgtgactatcccggcctgccgctgaacgagtcgatccgtaaggtcaccgagcag
accgagcggcaattccacgacgacgtcgatgcgctgggctgcctgcggccgaccgtcgag
ccgcgcgcgaccgagcatatcggcgagatgcggacgatcatcgaccggcttgtcgaaggc
ggcttcgcttatgtcgccgatgatcacgtgctgttttcgcccggcgcgatgaacgccgcc
gatagcgtgctgccgcgctacggcgcgctcgccaatcgctcgctcgacgaaatgatcgcc
ggcgcccgcgttgacgttgcgccctacaagcgcgacgccaccgacttcgtgctgtggaag
ccgtcgaagcccggcgagccgtcctggccgtcgccggccggcatcgcgacgcagggccgg
cccggttggcacatcgaatgctccgcgatgtcgtggaagcatctgggcgaaaccttcgac
atccacggcggcggcatcgacctggtgtttccgcatcacgagaacgaagtggcgcagtcg
tgctgcgcttttcacacctcgcgcatggcccagacctggatgcacaacggcttcctgcag
gtcgaaggcgagaagatgtcgaagagcctggggaatttcgtcacgatccgggaattgctg
gcgacggagaaattcggcgggcgcaagtgggacggagctacgctgcgtctcgcaatgctg
aaaacgcattatcggcagccgatcgattggaccgccgatgcgctgcacgaggctgagaag
gcgattttcgattggtccgacttcaccaaagacgcgacgcccgggtcttgcgacgacgtc
atcgccgcgctgaccgacgacctcaatacgcccaagatgatcgctgaattgcacgcgctg
cgtcgcgcgggcaaggccgatgaattgtgcggcgccatggagctgctcggcatttcacct
gtcgttcgcggcacggtcgatctcgatgcgacggcgaagtcgctgatcgatgcacgcacc
gccgcccgtgcgcgaaaagacttcaaggagtccgatcgcatccgcgatgaacttgccgcg
atgggcatcgcgatcaaggacggcaaggattcagacggcaagccggtgacgacctgggag
atcgcccgatga

DBGET integrated database retrieval system