KEGG   Rhodopseudomonas palustris BisB5: RPD_2086Help
Entry
RPD_2086          CDS       T00345                                 

Definition
(GenBank) Alcohol dehydrogenase, zinc-binding
  KO
K00001  alcohol dehydrogenase [EC:1.1.1.1]
Organism
rpd  Rhodopseudomonas palustris BisB5
Pathway
rpd00010  Glycolysis / Gluconeogenesis
rpd00071  Fatty acid degradation
rpd00350  Tyrosine metabolism
rpd00625  Chloroalkane and chloroalkene degradation
rpd00626  Naphthalene degradation
rpd01100  Metabolic pathways
rpd01110  Biosynthesis of secondary metabolites
rpd01120  Microbial metabolism in diverse environments
rpd01130  Biosynthesis of antibiotics
rpd01220  Degradation of aromatic compounds
Brite
KEGG Orthology (KO) [BR:rpd00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    RPD_2086
  09103 Lipid metabolism
   00071 Fatty acid degradation
    RPD_2086
  09105 Amino acid metabolism
   00350 Tyrosine metabolism
    RPD_2086
  09111 Xenobiotics biodegradation and metabolism
   00625 Chloroalkane and chloroalkene degradation
    RPD_2086
   00626 Naphthalene degradation
    RPD_2086
Enzymes [BR:rpd01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.1  alcohol dehydrogenase
     RPD_2086
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ADH_zinc_N ADH_N ADH_zinc_N_2 Glu_dehyd_C
Motif
Other DBs
NCBI-ProteinID: ABE39321
UniProt: Q139B8
Position
complement(2337120..2338142)
Genome map
AA seq 340 aa AA seqDB search
MRALTLVADRDLAVSDLPPPPPPAAGEVQIRVAAVALNHIDVWGYRGMAFVKRKLPIVVG
AEASGTIEAVGDGVTRFTPGQKVVMYGALTCGHCKACLEGRDNFCENVGGLIGFHVDGFA
RELMNIPARLVIPVPDGVSLRDAACAPIAFSTVQHMLFDNAKLQPGETILVHAGGSGIGT
VAIMMAKAIGCTVITTVGDDSKIEGVKKLGADYVINYRNDRFEHETRKITKKKGVDVVFE
HVGADTFNGSLLVMKRGGRLVTCGSTSGPTATINLMQLFQQQYRIFGSFGATMTNIAESL
DKMAAGMLPVIDTEVSLDDVGAALKRMESRQVFGKIIVHF
NT seq 1023 nt NT seq  +upstreamnt  +downstreamnt
atgcgcgcgctcactctcgttgccgatcgcgatctcgcggtctccgatctaccgccgccc
ccgccgcctgcggccggcgaggtgcagatccgcgtcgccgcggtcgcgctcaaccacatc
gacgtctggggctatcgcggcatggccttcgtcaagcgcaagctgccgatcgtggttggc
gcagaagcgtcgggcacgatcgaggcggtcggcgacggcgtgacccgattcacgcccggc
cagaaggtcgtgatgtacggcgcgctgacctgcggccactgcaaggcgtgcctcgaaggc
cgcgataatttctgcgagaatgtcggcggactgatcggcttccacgtcgacggcttcgcg
cgcgaactgatgaacatccctgctcggctggtgattccggtcccggacggcgtgagcctg
cgcgacgccgcctgcgcgccgatcgcgttctccaccgtgcagcacatgctgttcgacaac
gccaagctgcagccgggagagaccattctggtgcacgccggcggctccggcatcggcacc
gtcgcgatcatgatggcgaaagcgatcggctgcaccgtgatcaccacggtcggcgacgac
agcaagatcgaaggcgtcaagaagctcggcgcggactacgtcatcaactatcgaaacgac
cgcttcgagcacgagacgcgaaagatcaccaagaagaagggcgtcgacgtcgtattcgaa
cacgtcggcgccgacacgttcaacggctcgctgctggtgatgaagcgcggcggtcgcctc
gtgacctgcggctcgacctccggcccgaccgcgaccatcaacttgatgcagctgttccag
cagcagtaccgcatcttcggctcgttcggcgcgacgatgacgaacatcgccgaaagcctc
gacaagatggcggccgggatgctgccggtgatcgacacggaagtatcgctcgacgacgtc
ggcgccgcgctgaagcggatggaaagccgccaggtgttcggcaagatcatcgttcacttc
tga

DBGET integrated database retrieval system