KEGG   Rhodopseudomonas palustris BisB5: RPD_2425Help
Entry
RPD_2425          CDS       T00345                                 

Definition
(GenBank) Leucyltransferase
  KO
K00684  leucyl/phenylalanyl-tRNA---protein transferase [EC:2.3.2.6]
Organism
rpd  Rhodopseudomonas palustris BisB5
Brite
KEGG Orthology (KO) [BR:rpd00001]
 09190 Not Included in Pathway or Brite
  09191 Unclassified: metabolism
   99980 Enzymes with EC numbers
    RPD_2425
Enzymes [BR:rpd01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.2  Aminoacyltransferases
    2.3.2.6  lysine/arginine leucyltransferase
     RPD_2425
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Leu_Phe_trans Pertussis_S2S3
Motif
Other DBs
NCBI-ProteinID: ABE39655
UniProt: Q137T4
Position
complement(2703509..2704183)
Genome map
AA seq 224 aa AA seqDB search
MASRDSANADITPEVLLRAYACGIFPMAESIDDPTLFWVEPELRGIIPLGGFRVASRLAR
TVRSDVFTVTVNRDFRGVIDGCASPQPGRDDTWINRRIRELYIGLHGIGHCHSVEVWQDD
DLVGGLYGVSLGRAFFGESMFHRARDASKVALVHLVARLLAGGYELLDTQFVTEHLRSFG
AIEVPRQRYRALLDDALHGVADFGALPVDQPVSGAQALEIIAKN
NT seq 675 nt NT seq  +upstreamnt  +downstreamnt
atggcttcccgcgactccgccaatgccgacatcacgcccgaagtgctgctgcgtgcttac
gcgtgcggcatctttccgatggccgagagcatcgacgacccgacgctgttctgggtcgag
ccggagctgcgcggcatcatcccgctcggcggcttccgcgtcgcctcacgtctcgcccgc
accgtgcgctcggacgtcttcaccgtcaccgtcaaccgcgacttcaggggcgtgatcgac
ggctgcgcctcgccgcagcctggccgcgacgacacctggatcaaccgccgcatccgcgag
ctctatatcggcctgcacggcatcgggcattgtcatagcgtcgaggtctggcaggacgac
gacctcgtcggcggcctgtacggcgtcagcctcggccgcgccttcttcggcgagagcatg
tttcaccgcgcccgcgacgcctcgaaggtggcgctggtgcatctcgtcgcccgcctgctc
gcgggcggctacgagctgctcgacacccagttcgtgacggagcatctgcgcagcttcggt
gcaatcgaagtgccgcggcaacgctatcgcgcgctgctcgacgacgccctccacggcgtc
gccgacttcggcgcgctgccagtggatcagccggtctcgggcgcgcaagcactggagatc
atcgcgaagaactag

DBGET integrated database retrieval system