KEGG   Rhodopseudomonas palustris BisB5: RPD_2717Help
Entry
RPD_2717          CDS       T00345                                 

Definition
(GenBank) methionyl-tRNA synthetase
  KO
K01874  methionyl-tRNA synthetase [EC:6.1.1.10]
Organism
rpd  Rhodopseudomonas palustris BisB5
Pathway
rpd00450  Selenocompound metabolism
rpd00970  Aminoacyl-tRNA biosynthesis
rpd01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:rpd00001]
 09100 Metabolism
  09106 Metabolism of other amino acids
   00450 Selenocompound metabolism
    RPD_2717
 09120 Genetic Information Processing
  09122 Translation
   00970 Aminoacyl-tRNA biosynthesis
    RPD_2717
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01007 Amino acid related enzymes [BR:rpd01007]
    RPD_2717
  09182 Protein families: genetic information processing
   03016 Transfer RNA biogenesis [BR:rpd03016]
    RPD_2717
Enzymes [BR:rpd01000]
 6. Ligases
  6.1  Forming carbon-oxygen bonds
   6.1.1  Ligases forming aminoacyl-tRNA and related compounds
    6.1.1.10  methionine---tRNA ligase
     RPD_2717
Amino acid related enzymes [BR:rpd01007]
 Aminoacyl-tRNA synthetase
  Class I (U)
   RPD_2717
Transfer RNA biogenesis [BR:rpd03016]
 Eukaryotic type
  Aminoacyl-tRNA synthetases (AARSs)
   Multi-aminoacyl-tRNA synthetase complex (MSC)
    RPD_2717
 Prokaryotic type
   Other AARSs
    RPD_2717
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: tRNA-synt_1g tRNA-synt_1 tRNA-synt_1e tRNA-synt_1f Anticodon_1
Motif
Other DBs
NCBI-ProteinID: ABE39946
UniProt: Q136P3
Position
3032500..3034044
Genome map
AA seq 514 aa AA seqDB search
MAQRNSFYITTAISYPNGAPHIGHAYEAIATDALARFQRLDGKDVFFLTGTDEHGLKMIQ
TAQKEGIETHVLAARNAGRFRDMDDRFGVSYDRFIRTSEEQHHRSVQEVWKRMQANGDIY
LDSYAGWYSVRDEAYYAEDETIVGEDNVRRGPQGSPVEWVEEKSYFFKLSAYQDRLLKLY
EDQPDFIGPDSRRNEVISFVKGGLKDLSVSRTTFDWGVEVPGDPEHVMYVWVDALTNYIT
GVGFPDETDANWRYWPADVHVIGKDIIRFHAVYWPAFLMSAGIPVQKRVYAHGFLFNKGE
KMSKSVGNIVDPFNLADQYGVDQVRYFFLREVPFGSDGSYNHEAIVNRINADLANDLGNL
AQRSLTMIAKQCEAKVPEHGDFSDADKAMLAMADGMIAPARTAMATQQIHQALNAVWAVV
AEANRYFAGEAPWALAKTDPPRQKTVLYVTAEVLRQIGILAQPAIPGSATKLLDILGVAA
DARDFAALATRIKPGTPLPAPAPIFPRYVEPATV
NT seq 1545 nt NT seq  +upstreamnt  +downstreamnt
atggcgcagcgaaattcattctacatcaccaccgcgatctcctacccgaacggcgcgccg
catatcggccacgcctatgaggcgatcgcgaccgacgcgctggcgcgattccagcggctc
gacggcaaggatgtgttcttcctgaccggcaccgacgagcacgggctgaaaatgatccag
accgcgcagaaggaggggatcgagacccacgttctcgccgcccgcaacgccggccgcttc
cgcgacatggacgatcgcttcggcgtgtcctacgaccgcttcatccgcacctcggaggag
cagcatcatcgctcggtccaggaggtctggaagcggatgcaggcgaacggcgatatctat
ctcgacagctatgccggctggtactcggtccgcgacgaggcctattacgccgaggacgaa
accattgtcggcgaggacaatgtgcgccgcggcccgcagggctcaccggtggagtgggtc
gaggagaagagctacttcttcaaactgtcggcctatcaggacagactgctgaagctgtat
gaggatcaaccggatttcatcggccccgactcgcgccgcaacgaggtgatcagcttcgtc
aagggcgggctcaaggacctctcggtgtcgcgcaccactttcgactggggcgtcgaggtg
ccgggcgaccccgagcatgtgatgtatgtctgggtcgatgcgctgaccaactacatcacc
ggcgtcggcttccccgacgagaccgacgccaactggcgctactggccggccgacgtccac
gtcatcggcaaggatatcatccgcttccacgcggtgtactggccggcgttcctgatgtcg
gcgggcatcccggtgcagaagcgcgtctacgcccacggattcctgttcaacaagggcgag
aagatgtcgaagtcggtcggcaacatcgtcgacccgttcaatctcgccgaccaatacggc
gttgaccaggtgcgctatttcttcctgcgcgaggtgccgttcggctcggacggcagctac
aatcacgaggcgatcgtcaaccgcatcaacgccgacctcgccaatgatctcggcaatctg
gcgcagcgttcgctgaccatgatcgccaagcagtgcgaggccaaggtgccggagcacggc
gacttcagcgacgccgacaaggcgatgctggcgatggccgacggcatgatcgcgccggcg
cggaccgcgatggcgacgcagcagatccatcaggcgctgaacgcggtgtgggcggtggtg
gcggaagccaatcgctacttcgcgggcgaagcgccgtgggcgctggccaagaccgatccg
ccgcggcagaagacggtgctctacgtcaccgccgaggtgcttcgccagatcggcattctg
gcgcaacccgcgattccgggttcggcgacgaagctgctcgacattctcggcgtcgccgcg
gatgcgcgtgacttcgcggctctggcgacacggatcaagcccggcacgccactgccggcc
ccggcgccgatcttcccgcgctatgtcgagccggcgacggtgtga

DBGET integrated database retrieval system