KEGG   Rhodopseudomonas palustris BisB5: RPD_2809Help
Entry
RPD_2809          CDS       T00345                                 

Definition
(GenBank) Dihydrolipoamide acetyltransferase, long form
  KO
K00627  pyruvate dehydrogenase E2 component (dihydrolipoamide acetyltransferase) [EC:2.3.1.12]
Organism
rpd  Rhodopseudomonas palustris BisB5
Pathway
rpd00010  Glycolysis / Gluconeogenesis
rpd00020  Citrate cycle (TCA cycle)
rpd00620  Pyruvate metabolism
rpd01100  Metabolic pathways
rpd01110  Biosynthesis of secondary metabolites
rpd01120  Microbial metabolism in diverse environments
rpd01130  Biosynthesis of antibiotics
rpd01200  Carbon metabolism
Module
rpd_M00307  Pyruvate oxidation, pyruvate => acetyl-CoA
Brite
KEGG Orthology (KO) [BR:rpd00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    RPD_2809
   00020 Citrate cycle (TCA cycle)
    RPD_2809
   00620 Pyruvate metabolism
    RPD_2809
Enzymes [BR:rpd01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.12  dihydrolipoyllysine-residue acetyltransferase
     RPD_2809
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 2-oxoacid_dh Biotin_lipoyl E3_binding Biotin_lipoyl_2 RnfC_N GCV_H QRPTase_N
Motif
Other DBs
NCBI-ProteinID: ABE40037
UniProt: Q136F2
Position
complement(3130398..3131819)
Genome map
AA seq 473 aa AA seqDB search
MPINILMPALSPTMEKGNLAKWLKKEGDKVKSGDVIAEIETDKATMEVEASDEGTLAKIL
VPEGTQDVAVNAVIAVLAGDGEDVEAAGAGAGKAEAPKAEAAKAEDVKKPAASSVETTAA
RAPQDDGGAAGKGAADAAPRPAEGAKAPGSKGDAMRAKPAQSSDARVFSSPLARRLAKDA
GIDLARVEGTGPHGRVIARDVEQAKAGGGLKAPAAAASSAAPAVAPSMSDQQIRALYPEG
SYEAVPHDGMRRTIAQRLTQSTQTIPHFYLTIDCNLDRLMAAREDINAAAPKDKDGKPAY
KLSVNDFVIKAMAVALQRIPDANVSWTEAGMLKHRHSDIGVAVAMPGGLITPIIRSAETA
SLSAISKQMKDFAARARARKLKPDEYQGGTTAISNLGMYGIKDFTAVINPPHATILAVGA
GEQRPIVRDGKIEIATMMSVTLSCDHRAVDGALGAELIGAFKTLIENPVMMMV
NT seq 1422 nt NT seq  +upstreamnt  +downstreamnt
atgccgatcaacatcctgatgcccgcgctctcgccgaccatggagaagggcaaccttgcg
aagtggctgaaaaaggagggcgacaaggtcaagagcggcgacgtcatcgccgagatcgag
accgacaaggcgacgatggaagtcgaggcctccgacgaggggacgctggcgaagatcctc
gtcccggaaggaacccaggatgtcgcggtcaatgccgtgatcgccgtgctcgccggcgac
ggcgaggacgtcgaggcggccggggcaggggccggcaaggcggaggcgccgaaggctgag
gctgcaaaggccgaggacgtgaagaagcccgcggcgtcatccgtcgagacgaccgctgcg
cgggctcctcaggatgacggcggcgcggctggcaagggcgctgcagatgctgcccctcgg
cctgcggaaggcgcgaaagcgcccggctcgaagggcgacgccatgcgggccaaacccgcg
caatccagcgacgcccgggtgttctcctcgccgctggcgcggcggctcgccaaggatgcc
ggcattgatctggcgcgtgtcgagggcactggcccgcacggccgggtgatcgcccgcgac
gtcgagcaggcgaaggcgggaggcggactgaaggcgcccgcggcggcggcatcgtccgct
gcgccggcggtcgcgccgtcgatgtcggaccagcagatccgcgcgctgtatccggagggc
agctacgaggccgtgccgcacgacgggatgcggcggacgattgcgcagaggctgacgcaa
tcgacccagaccatcccgcatttctacctgacgatcgactgcaacctcgatcggctgatg
gcggcgcgcgaagatatcaacgccgccgcgccgaaggacaaggacggcaagccggcctac
aagctgtcggtcaacgacttcgtcatcaaggcgatggcggtggcgctgcagcgcattccc
gacgccaatgtgtcgtggacggaagccggtatgctcaagcacaggcattccgacatcggc
gtcgcggtggcgatgccgggcggattgatcaccccgatcatccgcagcgccgagacggcg
tcgctgtcggcgatctccaagcagatgaaggatttcgcagcccgcgcccgcgcgcgaaaa
ctgaagccggacgagtatcagggcggcaccacggcgatctccaacctcggcatgtacggc
atcaaggacttcaccgcggtaatcaacccgccgcacgccaccatcctggcggtcggcgcc
ggcgagcagcgcccgatcgtccgggacggcaagatcgagatcgcgacgatgatgagcgtg
acgctgagttgcgatcaccgcgccgtcgacggcgcgctcggcgccgaactgatcggcgcg
ttcaagacgctgatcgaaaatcccgtgatgatgatggtgtag

DBGET integrated database retrieval system