KEGG   Rhodopseudomonas palustris BisB5: RPD_2826Help
Entry
RPD_2826          CDS       T00345                                 

Definition
(GenBank) triosephosphate isomerase
  KO
K01803  triosephosphate isomerase (TIM) [EC:5.3.1.1]
Organism
rpd  Rhodopseudomonas palustris BisB5
Pathway
rpd00010  Glycolysis / Gluconeogenesis
rpd00051  Fructose and mannose metabolism
rpd00562  Inositol phosphate metabolism
rpd00710  Carbon fixation in photosynthetic organisms
rpd01100  Metabolic pathways
rpd01110  Biosynthesis of secondary metabolites
rpd01120  Microbial metabolism in diverse environments
rpd01130  Biosynthesis of antibiotics
rpd01200  Carbon metabolism
rpd01230  Biosynthesis of amino acids
Module
rpd_M00002  Glycolysis, core module involving three-carbon compounds
rpd_M00003  Gluconeogenesis, oxaloacetate => fructose-6P
Brite
KEGG Orthology (KO) [BR:rpd00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    RPD_2826
   00051 Fructose and mannose metabolism
    RPD_2826
   00562 Inositol phosphate metabolism
    RPD_2826
  Energy metabolism
   00710 Carbon fixation in photosynthetic organisms
    RPD_2826
Enzymes [BR:rpd01000]
 5. Isomerases
  5.3  Intramolecular oxidoreductases
   5.3.1  Interconverting aldoses and ketoses, and related compounds
    5.3.1.1  triose-phosphate isomerase
     RPD_2826
Exosome [BR:rpd04147]
 Exosomal proteins
  Exosomal proteins of colorectal cancer cells
   RPD_2826
  Exosomal proteins of bladder cancer cells
   RPD_2826
  Exosomal proteins of melanoma cells
   RPD_2826
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: TIM
Motif
Other DBs
NCBI-ProteinID: ABE40054
UniProt: Q136D5
Position
complement(3147935..3148708)
Genome map
AA seq 257 aa AA seqDB search
MPVPAVRSLIAGNWKMNGLKAASSEFDAMLEGATELSSGIDLLVCPPATLIAAFADRLAA
NEKGALAVAIGAQDCHANATGAHTGDISAEMLADAGARAIIVGHSERRADHGETDAIVRT
KAQAAWRAGLVAIVCVGETQGERNAGHTLDVVAGQLAGSLPDGATAANLVVAYEPVWAIG
TGMTPTAADVEEVHGFIRQTLTQRFNAEGDQMRLLYGGSVKPSNARELMSVPHVNGALVG
GASLKASDFLAIAAGCP
NT seq 774 nt NT seq  +upstreamnt  +downstreamnt
atgccggtccccgccgttcgttcgctgattgccggaaactggaagatgaacggcctcaag
gccgcgtcgtcggagttcgacgctatgctggagggcgcgaccgagctgtcatcggggatc
gatctgctggtgtgcccgccggcaacgctgatcgccgcgtttgccgacaggcttgccgcc
aacgagaagggcgcgcttgcggtcgcgatcggcgcccaggattgccatgccaacgccacc
ggcgcccataccggcgacatctcggccgaaatgctggccgacgccggcgcccgcgcgatc
atcgtcggtcattccgagcgccgcgccgatcacggcgagaccgacgcgatcgtccgcacc
aaggcgcaggcggcgtggcgggccgggctggtcgcgatcgtctgcgtcggcgagacccag
ggcgaacgcaatgccgggcacactctggacgttgtcgccggccagctcgccggctcgctg
cccgacggcgccaccgccgccaatctggtggtggcctatgagccggtctgggcgatcggc
accggcatgaccccgaccgcggctgatgtcgaggaagttcatggctttattcgtcagact
ctgacgcagcgctttaacgccgaaggcgaccagatgcggctgctgtatggcggctcggtg
aagccctcgaatgcccgcgaactgatgtcagtcccgcatgtcaacggcgcgctggtcggc
ggcgccagcctgaaggcgtcggacttccttgcgattgccgccgggtgtccctaa

DBGET integrated database retrieval system