KEGG   Rhodopseudomonas palustris BisB5: RPD_2972Help
Entry
RPD_2972          CDS       T00345                                 

Definition
(GenBank) Alcohol dehydrogenase GroES-like
  KO
K00001  alcohol dehydrogenase [EC:1.1.1.1]
Organism
rpd  Rhodopseudomonas palustris BisB5
Pathway
rpd00010  Glycolysis / Gluconeogenesis
rpd00071  Fatty acid degradation
rpd00350  Tyrosine metabolism
rpd00625  Chloroalkane and chloroalkene degradation
rpd00626  Naphthalene degradation
rpd01100  Metabolic pathways
rpd01110  Biosynthesis of secondary metabolites
rpd01120  Microbial metabolism in diverse environments
rpd01130  Biosynthesis of antibiotics
rpd01220  Degradation of aromatic compounds
Brite
KEGG Orthology (KO) [BR:rpd00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    RPD_2972
  Lipid metabolism
   00071 Fatty acid degradation
    RPD_2972
  Amino acid metabolism
   00350 Tyrosine metabolism
    RPD_2972
  Xenobiotics biodegradation and metabolism
   00625 Chloroalkane and chloroalkene degradation
    RPD_2972
   00626 Naphthalene degradation
    RPD_2972
Enzymes [BR:rpd01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.1  alcohol dehydrogenase
     RPD_2972
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ADH_N ADH_zinc_N ADH_zinc_N_2 NAD_binding_2 Sacchrp_dh_NADP DapB_N
Motif
Other DBs
NCBI-ProteinID: ABE40198
UniProt: Q135P1
Position
3311348..3312406
Genome map
AA seq 352 aa AA seqDB search
MTQMRRQSLVKFDAPLCETIIDAPKPQGREVLVRIERCGLCHSDLHIQDGYADLGGGKKL
DTTRGMTLPFTLGHEIAGVVDQVGPDAPADLIGKKMAVFPWIGCGKCRDCLTGDENLCAR
NRFLGVSIDGGFATHVLVPDAKYLLDYDPLPTNVAATLMCSGITAYGALKRLVDRPRQRN
ILLIGLGGVGMMGLSLAQAMFKQPISVADLSEAAREAALKNGASFAYDPSEPDVIKRIVK
ETDGGFDCVVDFAGNDKSMNFAVGAVARGGKIVVSGLMGGQFSLPMVQWIYKRMTVEGFM
VGTLEETKELLALARTGKIKPTPMKEEPMGDAQKWIDQLRAGKVVGRIMLTN
NT seq 1059 nt NT seq  +upstreamnt  +downstreamnt
atgacgcagatgcgtcgccaatctctggtgaaattcgacgccccgctgtgcgagaccatc
atcgacgcgccaaagccgcaaggccgcgaagtgctggtccggatcgaacgctgcggtttg
tgccactccgatctgcatattcaggacggctatgccgacctcggcggcggcaagaagctc
gacaccacgcgcggcatgacgctgccgttcacgctggggcacgagattgccggcgtcgtc
gatcaagtcggccccgatgcgcccgccgatctgatcggcaagaagatggcggtgtttccc
tggatcggctgcggcaagtgccgcgactgcctgaccggcgacgagaacctctgcgcccgg
aaccgcttcctcggcgtctcgatcgacggcggcttcgccacgcatgtgctggtgcccgat
gcgaagtacctgctcgactacgatccgctgccgaccaatgtcgcggcgacgctgatgtgc
tccggcatcaccgcttatggcgcgctgaagcgccttgtcgatcggccgcgccagcgcaac
atcctgctgatcggtctcggcggcgtcggcatgatgggcctatcgctggcccaggcgatg
ttcaaacagccgatctcggtcgccgatctcagcgaggctgcgcgcgaggctgcgctcaag
aatggcgcgtccttcgcgtatgatccgtcggaacctgatgtgatcaagcgcatcgtcaag
gaaaccgatggcggcttcgactgcgtggtcgatttcgccggcaacgacaagtcgatgaac
tttgcggtcggcgcagtggcgcgcggcggcaagatcgtcgtgtccgggctgatgggcgga
cagttcagcctgccgatggtgcaatggatctacaagcgcatgaccgtcgaaggcttcatg
gtcggcacgttggaagagaccaaggagctcttggcgctggcgcgtaccggcaagatcaag
ccgacgccgatgaaggaagagccgatgggcgacgcgcaaaaatggatcgatcagttgcgc
gccggcaaggtcgtcggccgcatcatgctgacgaactaa

DBGET integrated database retrieval system