KEGG   Rhodopseudomonas palustris BisB5: RPD_3318Help
Entry
RPD_3318          CDS       T00345                                 

Definition
(GenBank) Thiolase
  KO
K00626  acetyl-CoA C-acetyltransferase [EC:2.3.1.9]
Organism
rpd  Rhodopseudomonas palustris BisB5
Pathway
rpd00071  Fatty acid degradation
rpd00072  Synthesis and degradation of ketone bodies
rpd00280  Valine, leucine and isoleucine degradation
rpd00310  Lysine degradation
rpd00362  Benzoate degradation
rpd00380  Tryptophan metabolism
rpd00620  Pyruvate metabolism
rpd00630  Glyoxylate and dicarboxylate metabolism
rpd00640  Propanoate metabolism
rpd00650  Butanoate metabolism
rpd00900  Terpenoid backbone biosynthesis
rpd01100  Metabolic pathways
rpd01110  Biosynthesis of secondary metabolites
rpd01120  Microbial metabolism in diverse environments
rpd01130  Biosynthesis of antibiotics
rpd01200  Carbon metabolism
rpd01212  Fatty acid metabolism
rpd02020  Two-component system
Brite
KEGG Orthology (KO) [BR:rpd00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00620 Pyruvate metabolism
    RPD_3318
   00630 Glyoxylate and dicarboxylate metabolism
    RPD_3318
   00640 Propanoate metabolism
    RPD_3318
   00650 Butanoate metabolism
    RPD_3318
  09103 Lipid metabolism
   00071 Fatty acid degradation
    RPD_3318
   00072 Synthesis and degradation of ketone bodies
    RPD_3318
  09105 Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    RPD_3318
   00310 Lysine degradation
    RPD_3318
   00380 Tryptophan metabolism
    RPD_3318
  09109 Metabolism of terpenoids and polyketides
   00900 Terpenoid backbone biosynthesis
    RPD_3318
  09111 Xenobiotics biodegradation and metabolism
   00362 Benzoate degradation
    RPD_3318
 09130 Environmental Information Processing
  09132 Signal transduction
   02020 Two-component system
    RPD_3318
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:rpd04147]
    RPD_3318
Enzymes [BR:rpd01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.9  acetyl-CoA C-acetyltransferase
     RPD_3318
Exosome [BR:rpd04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   RPD_3318
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Thiolase_N Thiolase_C ACP_syn_III ketoacyl-synt Ketoacyl-synt_C Ribonuc_red_2_N
Motif
Other DBs
NCBI-ProteinID: ABE40542
UniProt: Q134E7
Position
complement(3676349..3677518)
Genome map
AA seq 389 aa AA seqDB search
MTASIVGWAHMPFGKFDAETVESMIVRVANEAIADAGIAAGDVDEIVLGHFNAGFSPQDF
TAALVLQADPALRFKPATRVENACATGSAAVHQGIRAIEAGHAKVVLVVGVEQMTRTPGP
EIGKNLLRASYLPEDGETPAGFAGVFGIIAQKYFQKYGDQSDALAMIAAKNHHNGVSNPY
AQMRKDVGFEFCRAEGDKNPFVAGPLKRTDCSLVSDGAAALVLTSAENAKTMGKAVNIRA
TAHAQDFLPMSKRDILQFEGCTLAWQRALEQAGVTLNDLSFVETHDCFTIAELIEYEAMG
LTPKGQGARAIKEGWTLKTGKLPINPSGGLKAKGHPIGATGVSMHVLTAMQLLGQAPEGM
QIKDAKLGGIFNMGGAAVANYVSVLEPAK
NT seq 1170 nt NT seq  +upstreamnt  +downstreamnt
atgaccgccagcatcgttggatgggcgcatatgcccttcggcaaattcgacgccgagacc
gtcgagagcatgatcgtccgggtcgcgaacgaagccatcgcggacgccggtatcgcggcg
ggtgacgtcgatgaaatcgtgctcggtcatttcaacgccggcttctcgccgcaggatttc
accgcggcgctggtgctgcaggccgatccggcgctgcgcttcaagcccgccacccgcgtc
gagaacgcctgcgccaccggctccgccgccgtgcatcagggcatccgcgccatcgaagcg
ggccacgccaaggtggtcctggtcgtcggcgtcgagcagatgacccggacgccgggcccg
gagatcggcaagaatctgctgcgcgcctcgtatctgccggaagacggcgagacgcctgcc
ggcttcgccggcgtgttcggcatcattgcgcagaagtactttcagaaatacggcgaccag
tccgacgccctcgccatgatcgccgccaagaatcaccacaacggcgtgtccaatccctac
gcgcagatgcgtaaggacgttggcttcgagttctgtcgcgccgagggcgacaagaacccg
ttcgtcgccggtcccttgaagcgcaccgactgctcgctggtgtccgacggtgcggcggcc
ttggtgctgacctccgccgagaacgccaagacgatgggcaaggccgtcaacatccgcgcc
accgcacacgcgcaggacttcctgccgatgtcgaagcgcgacatcctgcagttcgaaggc
tgcacgctcgcctggcagcgtgcgctggagcaggccggcgtcacgctgaacgatctgtcc
ttcgtcgagacccatgactgcttcaccatcgccgaactgatcgagtatgaagcgatgggg
ctgacgccgaaggggcagggcgcgcgcgcgatcaaggaaggctggactctgaagaccggc
aagctgccgatcaatccgtccggcggtctcaaggccaagggccatccgatcggcgccacc
ggcgtgtcgatgcacgtgctgaccgcgatgcagctgctcggccaggcgccggaagggatg
cagatcaaggacgccaagctcggcggcatcttcaacatgggcggcgccgcagtcgccaac
tacgtctcggtgctcgagccggcgaagtaa

DBGET integrated database retrieval system