KEGG   Rhodopseudomonas palustris BisB5: RPD_3771Help
Entry
RPD_3771          CDS       T00345                                 

Definition
(GenBank) protoporphyrin IX magnesium-chelatase
  KO
K03405  magnesium chelatase subunit I [EC:6.6.1.1]
Organism
rpd  Rhodopseudomonas palustris BisB5
Pathway
rpd00860  Porphyrin and chlorophyll metabolism
rpd01100  Metabolic pathways
rpd01110  Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:rpd00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00860 Porphyrin and chlorophyll metabolism
    RPD_3771
Enzymes [BR:rpd01000]
 6. Ligases
  6.6  Forming nitrogen-D-metal bonds
   6.6.1  Forming coordination complexes
    6.6.1.1  magnesium chelatase
     RPD_3771
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Mg_chelatase AAA_5 AAA_22 MCM AAA_29 AAA_16 AAA DUF815 AAA_18
Motif
Other DBs
NCBI-ProteinID: ABE40992
UniProt: Q132J7
Position
complement(4209097..4210119)
Genome map
AA seq 340 aa AA seqDB search
MATVFPFSAIVGQEEMKLALLIAAIDQKVGGVLAFGDRGAGKSTAVRALAALLPKMKVVV
GCRYNCDPDVPERFCEECKEKAKHGKVKTAQVLVPVVDLPLGATEDRVVGALDLERALAK
GEKAFEPGLLARAHRGFLYIDEANLLEDHLVDLLLDVAASGENVVEREGLSIRHPARFVL
VGTGNPEEGELRPQLLDRFGMSVEVKTPDTLPERIEVVRRRDAFESDSTAFLEDWSKEEA
KLRRKITQAKDRLPDVSVPDAALERAARLCMTLGTDGLRGELTLMRAARALAALEHDKIV
TDDHLKRIAPSALRHRLRRNPLDDAGSSVRVDRALAEIFG
NT seq 1023 nt NT seq  +upstreamnt  +downstreamnt
atggcgacagtgttcccgttctccgccatcgtcggccaggaagagatgaaactcgccttg
ctgatcgcggcgatcgaccagaaggtcggcggcgtgctggcgttcggcgatcgcggcgcc
ggcaagtccaccgcggtgcgcgcgctggcggcgctgttgcccaagatgaaggtcgtggtc
ggctgccgctataattgcgatcccgacgtgcccgaacgcttctgcgaagagtgcaaggag
aaggccaagcacggcaaggtcaagaccgcgcaggtgctggtgccggtggtcgatctgccg
ctcggcgccaccgaagaccgggtcgtcggcgcgctcgatctcgaacgtgcgttggccaag
ggcgagaaggcatttgagccgggcctgctggcgcgggcgcatcgcggcttcctctacatc
gacgaagccaatctgctcgaagatcatctggttgatctgctgctcgacgtcgccgcctcc
ggcgagaacgtggtcgaacgcgaaggcctcagcatccgccatccggcgcgcttcgtgctg
gtcggcaccggcaaccccgaagaaggcgagctgcgtccgcaattgctcgaccggttcggc
atgtcggtcgaggtcaagacgcccgacacgctgccggaacgcatcgaagtggtgcgccgc
cgtgatgcgttcgagagcgattccaccgccttcctcgaagactggtcgaaggaagaggcc
aagctgcggcgcaagatcacccaggccaaggaccggttgcccgacgtcagcgtccccgac
gcggcgctggaacgcgccgccaggctgtgcatgacgctcggcaccgacggcctgcgcggc
gaattgacgctgatgcgcgccgcccgcgcgctcgcagcgctggagcacgacaagattgtc
accgacgatcatctgaagcggattgcgccgtcggcgctgcggcatcggctgcgccgcaat
cctctggacgacgcaggctcgagcgttcgtgtcgatcgggcgctcgctgaaatcttcgga
tga

DBGET integrated database retrieval system