KEGG   Rhodopseudomonas palustris BisA53: RPE_0277Help
Entry
RPE_0277          CDS       T00400                                 

Definition
(GenBank) porphobilinogen synthase
  KO
K01698  porphobilinogen synthase [EC:4.2.1.24]
Organism
rpe  Rhodopseudomonas palustris BisA53
Pathway
rpe00860  Porphyrin and chlorophyll metabolism
rpe01100  Metabolic pathways
rpe01110  Biosynthesis of secondary metabolites
rpe01120  Microbial metabolism in diverse environments
Brite
KEGG Orthology (KO) [BR:rpe00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00860 Porphyrin and chlorophyll metabolism
    RPE_0277
Enzymes [BR:rpe01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.24  porphobilinogen synthase
     RPE_0277
Exosome [BR:rpe04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   RPE_0277
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ALAD Arabinose_bd
Motif
Other DBs
NCBI-ProteinID: ABJ04236
UniProt: Q07UZ8
Position
complement(316349..317326)
Genome map
AA seq 325 aa AA seqDB search
MMVAGFPIVRPRRLRRTEALRHLVRETSVGAQDLIYPIFVEEQIDDAVPIATMPGVCRIP
ERKLAAEIEQIARDGIKAVLLFGISHHKDAAGSDSWNPDGLMARMVRIAKAAVPELVVIT
DNCFCEYTILGHCGTLRGGAVDNDATLLNLGRQAVVAIEAGADMVAPSAMMDGQIQAMRT
ALDKAGHSEAPIMAYSSKFASALYGPFRVAAGSELKGDRRSYQMDPMNGREALRESALDE
AEGADLLMVKPALAYLDVLAALRARTELPLVGYQVGGEYAMIKFAALAGALDEAATVRET
LGAIKRAGADLIISYFARDIAREGW
NT seq 978 nt NT seq  +upstreamnt  +downstreamnt
atgatggttgcgggttttccgattgtgcgtccgcggcggctgcgccgcaccgaagccctg
cgccacctggtgcgcgaaaccagcgtcggcgcccaagacctgatctatcccatcttcgtc
gaggaacagatcgacgacgccgtcccgatcgccacgatgcccggtgtgtgtcgtattccc
gagcgcaagctcgccgctgaaatcgagcagatcgcccgcgacggcatcaaggcggtgctg
ctgttcggcatttcgcatcataaggacgccgccggcagcgacagctggaacccggacggg
ctgatggcgcggatggtgcggattgccaaggcggcggtgcccgagctggtggtgatcacc
gacaattgcttctgcgaatacacgatcctcggccattgcggcacgttgcgcggcggcgcg
gtcgataacgacgccacgctgctcaatctcggccgccaggcggtggtggcgatcgaggcc
ggcgccgacatggtggcgccctcggcgatgatggacggccagattcaggcgatgcgcacc
gcgctcgacaaagccgggcatagcgaggcgccgatcatggcctattcctcgaaattcgcc
tcggcgctgtacgggccattccgggtcgccgccggttcggagctcaagggcgatcggcgg
agctatcagatggacccgatgaacggccgcgaggcgctgcgggaatccgcgctcgacgag
gcggagggcgccgatctgttgatggtgaagccggcgctggcctatctcgacgtgctggcg
gcgctgcgcgcgcgcaccgagctgccgctcgtcggctatcaggtcggcggcgaatacgcg
atgatcaaattcgccgcattggccggcgcgctcgacgaggccgcgaccgtgcgcgaaacg
ctgggcgcgatcaaacgcgccggtgccgatctgatcatcagctatttcgcccgcgacatc
gcgcgcgagggctggtga

DBGET integrated database retrieval system