KEGG   Rhodopseudomonas palustris BisA53: RPE_0673Help
Entry
RPE_0673          CDS       T00400                                 

Definition
(GenBank) acetyl-CoA acetyltransferases
  KO
K00626  acetyl-CoA C-acetyltransferase [EC:2.3.1.9]
Organism
rpe  Rhodopseudomonas palustris BisA53
Pathway
rpe00071  Fatty acid degradation
rpe00072  Synthesis and degradation of ketone bodies
rpe00280  Valine, leucine and isoleucine degradation
rpe00310  Lysine degradation
rpe00362  Benzoate degradation
rpe00380  Tryptophan metabolism
rpe00620  Pyruvate metabolism
rpe00630  Glyoxylate and dicarboxylate metabolism
rpe00640  Propanoate metabolism
rpe00650  Butanoate metabolism
rpe00900  Terpenoid backbone biosynthesis
rpe01100  Metabolic pathways
rpe01110  Biosynthesis of secondary metabolites
rpe01120  Microbial metabolism in diverse environments
rpe01130  Biosynthesis of antibiotics
rpe01200  Carbon metabolism
rpe01212  Fatty acid metabolism
rpe02020  Two-component system
Brite
KEGG Orthology (KO) [BR:rpe00001]
 Metabolism
  Carbohydrate metabolism
   00620 Pyruvate metabolism
    RPE_0673
   00630 Glyoxylate and dicarboxylate metabolism
    RPE_0673
   00640 Propanoate metabolism
    RPE_0673
   00650 Butanoate metabolism
    RPE_0673
  Lipid metabolism
   00071 Fatty acid degradation
    RPE_0673
   00072 Synthesis and degradation of ketone bodies
    RPE_0673
  Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    RPE_0673
   00310 Lysine degradation
    RPE_0673
   00380 Tryptophan metabolism
    RPE_0673
  Metabolism of terpenoids and polyketides
   00900 Terpenoid backbone biosynthesis
    RPE_0673
  Xenobiotics biodegradation and metabolism
   00362 Benzoate degradation
    RPE_0673
 Environmental Information Processing
  Signal transduction
   02020 Two-component system
    RPE_0673
Enzymes [BR:rpe01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.9  acetyl-CoA C-acetyltransferase
     RPE_0673
Exosome [BR:rpe04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   RPE_0673
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Thiolase_N Thiolase_C ketoacyl-synt ACP_syn_III ACP_syn_III_C
Motif
Other DBs
NCBI-ProteinID: ABJ04631
UniProt: Q07TV3
Position
743876..745084
Genome map
AA seq 402 aa AA seqDB search
MPEAYIYDHVRTPRGRGKADGALHEVTALALATVPLKALKERNNLKEDVVDDVILGVVDP
VGEAGSDIARFAAMNAGLGEAVPGIQISRFCASGLDAVNFAAAQIMSGQHELVIGGGAES
MSRIGIGASGGAWPMDPSMAVPSYFMPQGISADLIATKYGFSRDDVDAYAVQSQQRSAKS
WDEGRFAKSVVPVKDINGLTILAKDEHMRPNTTMQSLGQLQPSFAPMAAMGGFDAVAIQS
HPEIEKINFVHHAGNSSGIVDGAGAVLLGSKEAGAKHGLKPRAKIRAFVNIGSEPAMMLT
GPVDVTKKLFERSGMKKSDIDLFELNEAFASVVLRFMQAFEIDNDQINVNGGAIALGHPL
GATGAMILGTVLDELERTGKSTALVTLCIGGGMGTATIIERV
NT seq 1209 nt NT seq  +upstreamnt  +downstreamnt
atgcccgaggcctatatctacgatcacgttcgcaccccgcgcggccgcggcaaggccgat
ggcgcgctgcatgaggtgacggcgctggcgctcgccaccgtgccgctgaaggcgctgaag
gaacgcaacaacctcaaggaagacgtcgtcgacgacgtcatcctcggcgtggtcgatccg
gtcggcgaagccggctccgacatcgcgcgcttcgcggcgatgaacgccggtctcggcgag
gccgtgccgggcatccagatcagccggttctgcgcctcgggcctcgacgcggtgaatttc
gccgcggcccagatcatgagcggccagcacgaattggtgatcggcggcggcgcggaatcg
atgagccggatcggcatcggcgcctcgggcggcgcctggccgatggacccgtcgatggcg
gtgccgagctacttcatgccgcagggcatctcggccgatctgatcgcgaccaaatatggt
ttctcgcgcgatgacgtcgacgcctacgcggtgcagagccagcagcgttcggcgaaatcc
tgggacgaaggccgcttcgccaagtcggtggtgccggtcaaggacatcaacggcctgacg
atcttggccaaggacgagcacatgcggccgaacacgacgatgcagtcgctcggccagttg
cagccgtcgtttgcgccgatggcggcgatgggcggttttgatgcggtggcgatccagtcg
catccggaaatcgagaagatcaatttcgtgcatcacgccggcaactcctccggcatcgtc
gacggcgccggcgcggtgctgctcggcagcaaggaagccggcgcgaaacacggtctcaag
ccgcgggcgaaaatccgcgccttcgtcaatatcggctccgagccggcgatgatgctgacc
ggtccggtcgacgtcaccaaaaaactgttcgaacgctcgggcatgaagaagtccgacatc
gacctgttcgaactcaacgaggccttcgcctcggtggtgctgcgcttcatgcaggcgttc
gagatcgacaacgaccagatcaacgtcaatggcggcgcgatcgcgctcggccatccgctc
ggcgccaccggcgcgatgatcctgggcaccgtgctcgacgaattggagcgcaccggcaag
tcgaccgccttggtgacgctgtgcatcggcggcggcatgggcaccgcgacgatcatcgag
cgggtgtaa

DBGET integrated database retrieval system