KEGG   Rhodopseudomonas palustris BisA53: RPE_0796Help
Entry
RPE_0796          CDS       T00400                                 

Definition
(GenBank) GTP cyclohydrolase
  KO
K01495  GTP cyclohydrolase IA [EC:3.5.4.16]
Organism
rpe  Rhodopseudomonas palustris BisA53
Pathway
rpe00790  Folate biosynthesis
rpe01100  Metabolic pathways
Module
rpe_M00126  Tetrahydrofolate biosynthesis, GTP => THF
Brite
KEGG Orthology (KO) [BR:rpe00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00790 Folate biosynthesis
    RPE_0796
Enzymes [BR:rpe01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.4  In cyclic amidines
    3.5.4.16  GTP cyclohydrolase I
     RPE_0796
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: GTP_cyclohydroI QueF
Motif
Other DBs
NCBI-ProteinID: ABJ04752
UniProt: Q07TI2
Position
complement(886564..887166)
Genome map
AA seq 200 aa AA seqDB search
MTIHARIAAPSQTKPSPEEVEAAFRTLIRWAGDDPDRAGLKETPARAARAFREYFAGYEQ
DPLAILNKTFDETGGYEEMVVLRGIPFESHCEHHLAPIIGQAWVAYVPSGRVVGLSKLAR
VVDAYAKRLQIQERMTSEIAFAVQDVLKPQGVGVVIKATHHCMSSRGVHKVGADMVTSCM
LGCFRDNALTRQEFLAIANQ
NT seq 603 nt NT seq  +upstreamnt  +downstreamnt
ttgaccatccacgcccggattgctgcacccagccagaccaagccctcgcccgaggaagtc
gaagccgcgtttcgcaccctcattcgctgggccggcgacgatccggaccgtgccggcctc
aaggaaaccccggcgcgcgccgcgcgtgcgttccgcgagtatttcgccggctatgaacag
gacccgctggcgatcctgaacaagactttcgatgagaccggcggctatgaggaaatggtg
gtgctgcgtggcatcccgttcgagagccattgcgagcatcatttggcgccgatcatcggt
caggcgtgggtggcttacgtgcccagcgggcgggtggtcgggctgtcaaaactcgcgcgc
gtggtggacgcctacgccaagcggctgcagatccaggaacgcatgacctcggagatcgcc
ttcgcggtccaggacgtgctgaagccgcagggcgtcggcgtggtgatcaaggcgacgcat
cactgcatgtccagccgcggcgtgcacaaggtcggcgccgacatggtgaccagctgcatg
ctcggctgcttccgcgacaacgccctcacccgtcaggaatttttggccatcgccaaccaa
tga

DBGET integrated database retrieval system