KEGG   Rhodopseudomonas palustris BisA53: RPE_0871Help
Entry
RPE_0871          CDS       T00400                                 

Definition
(GenBank) ATP phosphoribosyltransferase (homohexameric) / ATP phosphoribosyltransferase regulatory subunit
  KO
K00765  ATP phosphoribosyltransferase [EC:2.4.2.17]
Organism
rpe  Rhodopseudomonas palustris BisA53
Pathway
rpe00340  Histidine metabolism
rpe01100  Metabolic pathways
rpe01110  Biosynthesis of secondary metabolites
rpe01230  Biosynthesis of amino acids
Brite
KEGG Orthology (KO) [BR:rpe00001]
 Metabolism
  Amino acid metabolism
   00340 Histidine metabolism
    RPE_0871
Enzymes [BR:rpe01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.2  Pentosyltransferases
    2.4.2.17  ATP phosphoribosyltransferase
     RPE_0871
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: HisG
Motif
Other DBs
NCBI-ProteinID: ABJ04827
UniProt: Q07TA7
Position
complement(971313..972290)
Genome map
AA seq 325 aa AA seqDB search
MSQPFVLAVPSKGRLQENAEAFFARAGLTLAKSGGARDYRGTIVGLDNVEVAYLSASEIA
ANLARGSVHFGVTGEDLIRESIVDADKRVALIDGLGFGRADVVVAVPQAWIDVRTMADLD
DVTTGFRAQHNRRMRVATKYINLTRGFFASHGVVDYRIVESAGATEGAPAVGTAELIVDI
TTTGATLAANGLRVLDDGVMLRSQANLVASREADWTDATRETARIILDHIASRARAGKFK
EVRTRFSGCNDALLAEAHAKFGVVSPFGGPTSSGMLTLHCPPAQLYGLSSFLRGHGAETV
SVVSLDYVMDRENPLFAKLEAFLRS
NT seq 978 nt NT seq  +upstreamnt  +downstreamnt
atgagccagcctttcgttctcgccgttccctcaaaaggccggctgcaggaaaacgccgaa
gcctttttcgcccgcgccgggctgacgctggccaagtccggcggcgcccgtgactatcgc
ggcaccattgtcggcctcgacaatgtcgaggtcgcctatctgtcggccagcgaaatcgcc
gccaatctggcgcgcggttcggtgcatttcggcgtcaccggagaagacctgattcgcgag
agcatcgtcgatgccgacaagcgcgtggcgctgatcgacgggctcggcttcggccgcgcc
gacgtcgtggtcgcggtgccgcaggcctggatcgacgtccgcaccatggccgacctcgac
gacgtcaccaccggctttcgcgcccagcacaatcggcggatgcgggtggcgaccaaatac
atcaatttgacgcgcggcttcttcgccagccacggcgtggtcgactaccgcatcgtggaa
agcgccggcgccaccgagggcgcgccagcggtcggcaccgcggagctgatcgtcgacatc
accaccaccggcgcgacgctggcggccaacggcttgagggtgctggacgacggcgtgatg
ctgcggagccaggccaatctggtggcctcgcgcgaggccgactggaccgacgccacgcgg
gagaccgcgcggatcatcctcgaccacatcgcctcgcgcgcccgcgccggcaagttcaag
gaagtccgcacccgcttctcgggctgcaatgacgcgctgctggccgaagcccacgccaaa
ttcggcgtggtgtcgccgttcggcggcccgacctcgtcgggaatgctgacactgcactgc
ccgccagcgcagctctacgggctgtcgagctttctgcgcggccacggcgccgagaccgtc
tcggtggtctcgctggactatgtgatggatcgcgagaacccgctgttcgccaaactcgag
gcgtttctgcggtcataa

DBGET integrated database retrieval system