KEGG   Rhodopseudomonas palustris BisA53: RPE_2196Help
Entry
RPE_2196          CDS       T00400                                 

Definition
(GenBank) protein-L-isoaspartate(D-aspartate) O-methyltransferase
  KO
K00573  protein-L-isoaspartate(D-aspartate) O-methyltransferase [EC:2.1.1.77]
Organism
rpe  Rhodopseudomonas palustris BisA53
Brite
Enzymes [BR:rpe01000]
 2. Transferases
  2.1  Transferring one-carbon groups
   2.1.1  Methyltransferases
    2.1.1.77  protein-L-isoaspartate(D-aspartate) O-methyltransferase
     RPE_2196
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PCMT RrnaAD Methyltransf_25 GCD14 Methyltransf_31 Ubie_methyltran Methyltransf_11 Methyltransf_12 Fibrillarin PrmA Methyltr_RsmB-F ADH_zinc_N MTS CMAS Methyltransf_3
Motif
Other DBs
NCBI-ProteinID: ABJ06138
UniProt: Q07PJ6
Position
2432315..2433157
Genome map
AA seq 280 aa AA seqDB search
MMTNDRLQKIRTLYAELIAGHHDARLREAFAAVPREPFAGPGPWLMKGQGEKYIQTPDDD
PALLYQDVRLALDAARNINIGMPSAHAMWLDAIRLDPGQQVLQVGTGSGYYTAILAHLVG
PRGRVFAYEIDQDFAARARANLSDLPQVEVRATSGIADDLPKVDAIYVCAGITQPSRAWI
DALRPGGRLLFPLQPPLGLGGMLLIECPLHDTAWPARFVSRAAFVGCVGQQDAAAGARLA
AAFAGRWDQVRSFRIDDAPDDSCWYAGDGWWLSTTAVDVG
NT seq 843 nt NT seq  +upstreamnt  +downstreamnt
atgatgaccaacgatcgattgcagaaaatccggacgctttacgccgagctgatcgccggc
catcacgacgcgcggctgcgcgaggcgttcgccgccgtgccgcgcgagccgttcgccggg
ccgggcccctggctgatgaaagggcagggcgagaagtatatccaaaccccggatgacgat
ccggcgttgctgtatcaggacgtgcggctggcgttggatgccgcgcgcaatatcaacatc
ggcatgccgagcgcgcatgcgatgtggctcgacgcgatccggctcgatccgggccaacag
gtgctgcaggtcggcactggctccggctactacaccgcgatcctggcgcatctggtcggg
ccgcgcggtcgcgtctttgcctacgagatcgatcaagattttgccgcgcgcgcccgcgca
aacctcagtgacctgccgcaggtcgaggtgagggcgacaagcggcatcgccgacgatctg
ccgaaggtcgatgcgatctacgtctgcgccggcatcacccagccgagccgggcctggatc
gacgcgctcaggcccggcgggcggctgttatttccgctgcagccgccgcttggcctcgga
ggcatgctgctgatcgagtgtccgctgcacgacaccgcgtggccggcaaggttcgtctcg
cgcgccgccttcgtcggctgcgtcggtcaacaggacgccgcagccggagcgcggctggcc
gcggcgttcgcgggccgatgggatcaggtgcgttcgttccggatcgacgacgctcccgac
gatagctgctggtatgccggcgacggctggtggctatcgaccacggcggtcgatgtggga
tag

DBGET integrated database retrieval system