KEGG   Rhodopseudomonas palustris BisA53: RPE_2935Help
Entry
RPE_2935          CDS       T00400                                 

Definition
(GenBank) haloacid dehalogenase, type II
  KO
K01560  2-haloacid dehalogenase [EC:3.8.1.2]
Organism
rpe  Rhodopseudomonas palustris BisA53
Pathway
rpe00361  Chlorocyclohexane and chlorobenzene degradation
rpe00625  Chloroalkane and chloroalkene degradation
rpe01100  Metabolic pathways
rpe01120  Microbial metabolism in diverse environments
Brite
KEGG Orthology (KO) [BR:rpe00001]
 09100 Metabolism
  09111 Xenobiotics biodegradation and metabolism
   00625 Chloroalkane and chloroalkene degradation
    RPE_2935
   00361 Chlorocyclohexane and chlorobenzene degradation
    RPE_2935
Enzymes [BR:rpe01000]
 3. Hydrolases
  3.8  Acting on halide bonds
   3.8.1  In carbon-halide compounds
    3.8.1.2  (S)-2-haloacid dehalogenase
     RPE_2935
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: HAD_2 Hydrolase Hydrolase_like
Motif
Other DBs
NCBI-ProteinID: ABJ06872
UniProt: Q07MG2
Position
complement(3287392..3288120)
Genome map
AA seq 242 aa AA seqDB search
MRAMPDLHLVKAMVFDVFGTVVDWRTSLIGDFTHWSENHGISADWPALVDAWRQAHVPAM
EEVRQHPERGFQPLDVLHRQSLERLVEEFGIKDLAELHLDYLNRGWHRLNPWPDSVEGLT
ALKRNFIIAPLSNGNVALLTNMAKYAGLPWDLILSAELFEHYKPDPETYLGAARLLGLRP
DQVMMVAAHNYDLAAAQALGLRTAFVPRTTEYGPLQVRDFEAEGTWDLVAKDFVDLAAKM
GC
NT seq 729 nt NT seq  +upstreamnt  +downstreamnt
atgcgcgcgatgcccgatctgcatctggttaaggcgatggtgttcgacgtgttcggcacc
gtcgtcgactggcgcaccagcctgatcggcgacttcacgcactggtcggaaaaccacggc
atcagcgccgattggccggcgctggttgatgcctggcggcaggctcatgtgccggcaatg
gaggaggtgcgccagcatcccgagcgtggctttcagccgctcgatgtgctgcatcggcaa
tcgctggagcggctggtcgaggagttcggtatcaaagatctcgccgagctgcatctcgac
tatctcaatcgcggctggcaccggctcaatccctggccggacagcgttgaggggctcact
gcgctgaagcgtaacttcatcatcgcgcctttgtcgaacggcaatgtcgcgctgctgacc
aatatggcgaaatacgccggcctgccctgggacctgatcctcagcgccgaattgttcgag
cactacaagcccgatcccgagacctatctcggcgctgcaaggctgctcgggctgcgtccg
gaccaggtgatgatggtggccgcgcacaattacgacctcgccgccgcgcaggccttgggg
ttgaggaccgctttcgtgccgcgcaccaccgaatacgggccgctacaggtccgggatttc
gaggccgagggtacctgggacctggtcgccaaggattttgtcgacctcgctgccaagatg
ggctgctag

DBGET integrated database retrieval system