KEGG   Rhodopseudomonas palustris BisA53: RPE_3047Help
Entry
RPE_3047          CDS       T00400                                 

Definition
(GenBank) phosphate transporter
  KO
K03306  inorganic phosphate transporter, PiT family
Organism
rpe  Rhodopseudomonas palustris BisA53
Brite
KEGG Orthology (KO) [BR:rpe00001]
 09190 Not Included in Pathway or Brite
  09193 Unclassified: signaling and cellular processes
   99977 Transport
    RPE_3047
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PHO4
Motif
Other DBs
NCBI-ProteinID: ABJ06984
UniProt: Q07M50
Position
complement(3412098..3413102)
Genome map
AA seq 334 aa AA seqDB search
MDATLGLPILIGLIAVALLFDFLNGLHDAANSIATIVSTRVLRPQYAVLWAAFFNFIAFL
VFGLHVATTIGTGIIQPGVIDAQVIFGALMGAIVWNIITWALGIPSSSSHALIGGLLGAG
VAKAGLSAAVWGGLTKALLAIVLSPLVGFLLALLLVAIVSWASVRSTPFAVDRAFRILQF
VSASLYSLGHGGNDAQKTMGIIAVLLYSQGYLGAEFSVPFWVVISCQAAMALGTLLGGWR
IVRTMGLRITKLTPMQGFCAETGGAATLFAATFLGVPVSTTHTITGAIVGVGAARRMSAV
RWNVASSIVYAWVITIPASAIVAAAAYYAVLLVR
NT seq 1005 nt NT seq  +upstreamnt  +downstreamnt
gtggacgccacgctgggtctcccgatcctgatcggactgattgctgtcgcgctcttgttc
gattttttgaacgggctgcacgacgccgccaattcgatcgccaccatcgtctcgaccagg
gtgctgcggccgcaatatgcggtgttgtgggcggcgttcttcaatttcatcgccttcctg
gtgttcggcctgcacgtcgccaccacgatcggcaccggcatcatccagcccggcgtgatc
gatgcccaggtgatctttggcgccctgatgggcgcgatcgtctggaacatcatcacctgg
gcgctcggcatcccgtcgagttcctcgcatgcgctgatcggcggactgctcggcgccggc
gtcgccaaggccggattgtcggccgcggtgtggggcgggctgacgaaggcgctgctggcg
atcgtgctgtcgcccttggtcggcttcctgctggcgctgctgctggtggcgatcgtatcc
tgggcctcggtgcgctcgacgccgttcgcggtcgaccgcgccttccggatcctgcaattc
gtctcggcctcgctgtattcgctgggccacggcggcaacgacgcccagaagaccatgggc
atcatcgccgtgcttttgtactcgcagggctatctcggggccgaattctcggtgccgttc
tgggtggtgatctcgtgccaggcggcgatggcgctcggcacgcttttgggcggctggcgg
atcgtgcgcaccatggggctgcgcatcaccaaactgaccccgatgcagggattttgcgcc
gaaaccggcggcgcggcgacgctgttcgcggcgaccttcctcggcgtgccggtctccacc
acccacaccatcaccggcgcgatcgtcggcgtcggcgcggcgcggcggatgtcggcggtg
cgctggaatgtcgccagttccatcgtctacgcctgggtcatcaccatccccgcttcggcg
atcgtcgccgccgcggcctattatgcggtgctgctagttcgctga

DBGET integrated database retrieval system