KEGG   Rhodopseudomonas palustris BisA53: RPE_3202Help
Entry
RPE_3202          CDS       T00400                                 

Definition
(GenBank) succinyl-CoA synthetase (ADP-forming) alpha subunit
  KO
K01902  succinyl-CoA synthetase alpha subunit [EC:6.2.1.5]
Organism
rpe  Rhodopseudomonas palustris BisA53
Pathway
rpe00020  Citrate cycle (TCA cycle)
rpe00640  Propanoate metabolism
rpe00660  C5-Branched dibasic acid metabolism
rpe01100  Metabolic pathways
rpe01110  Biosynthesis of secondary metabolites
rpe01120  Microbial metabolism in diverse environments
rpe01130  Biosynthesis of antibiotics
rpe01200  Carbon metabolism
Module
rpe_M00009  Citrate cycle (TCA cycle, Krebs cycle)
rpe_M00011  Citrate cycle, second carbon oxidation, 2-oxoglutarate => oxaloacetate
Brite
KEGG Orthology (KO) [BR:rpe00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    RPE_3202
   00640 Propanoate metabolism
    RPE_3202
   00660 C5-Branched dibasic acid metabolism
    RPE_3202
Enzymes [BR:rpe01000]
 6. Ligases
  6.2  Forming carbon-sulfur bonds
   6.2.1  Acid-thiol ligases
    6.2.1.5  succinate---CoA ligase (ADP-forming)
     RPE_3202
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: CoA_binding Succ_CoA_lig Ligase_CoA CoA_binding_2 GFO_IDH_MocA
Motif
Other DBs
NCBI-ProteinID: ABJ07137
UniProt: Q07LP7
Position
complement(3566183..3567103)
Genome map
AA seq 306 aa AA seqDB search
MIILRKEHRVLVQGITGKQGSFWTEKMRSVGTRIVAGVNPKRAGETHLGIPVYASARAAM
AETPFDVAVMFIPPALAEEAALDAIEAGAQLLVVLTEHIPIHDQMVIHAAARRNGTRILG
PNTAGLVTPGEGFAGIMPGHNGSIFQPGVVGVVSRSGSLGTLVSLNLTRAGLGQSAFIGI
GGDPMIGTTTRDALEALDRDPRTRAVVLVGEIGGAMEEEAATYAARMTKPVVAFIAGRAS
PPGKKMGHAGAIVGAAGGSYAGKREALERAGVTVVDTPAEIPDAVRARLAVQPPVETKQI
AVTPHP
NT seq 921 nt NT seq  +upstreamnt  +downstreamnt
atgatcattctgcgcaaggagcatcgcgtgctggtgcaggggatcaccggcaagcagggc
tcgttctggaccgagaagatgcggagcgtcggcacccggatcgtggccggcgtcaatccg
aagcgggcgggcgagacgcatctcggcatacccgtgtatgcctcggcccgcgcggcgatg
gcggaaacgccgttcgacgtcgcggtgatgttcatcccgccggcgctcgccgaggaggcc
gcgctcgacgcgatcgaggctggtgcgcaattgctcgtcgtgctcaccgagcacataccg
atccacgaccagatggttattcacgccgcggcgcgccgaaacggcacgcgcattctgggg
ccgaacaccgcggggctggtgacgccgggagagggctttgccggaatcatgcccgggcac
aacggcagcatcttccagcccggtgtggtcggcgtggtgtcgcgcagcggcagcctcggc
acgctggtgtcgctcaatctcacccgcgccgggctcggccagtccgcattcatcggcatc
ggcggcgatccgatgatcggcaccacgacgcgcgacgcgctcgaagcgctcgaccgcgac
ccgcgcacgcgggcagtcgtgctggtcggcgagatcggcggcgcgatggaggaggaggca
gctacctatgcggcgcgcatgaccaagccggtcgttgccttcatcgccgggagggcttct
ccgccaggcaagaagatgggccacgccggcgccattgtcggcgccgcgggcggcagctac
gcgggcaagcgcgaggcgcttgagcgcgccggcgtcaccgtcgtcgacacccccgccgaa
atcccggatgccgtgcgcgcccgacttgccgtgcagccgccggttgaaaccaaacagata
gccgtcaccccgcacccgtag

DBGET integrated database retrieval system