KEGG   Rhodopseudomonas palustris BisA53: RPE_3495Help
Entry
RPE_3495          CDS       T00400                                 

Definition
(GenBank) NAD-dependent epimerase/dehydratase
  KO
K08678  UDP-glucuronate decarboxylase [EC:4.1.1.35]
Organism
rpe  Rhodopseudomonas palustris BisA53
Pathway
rpe00520  Amino sugar and nucleotide sugar metabolism
rpe01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:rpe00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00520 Amino sugar and nucleotide sugar metabolism
    RPE_3495
Enzymes [BR:rpe01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.1  Carboxy-lyases
    4.1.1.35  UDP-glucuronate decarboxylase
     RPE_3495
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: GDP_Man_Dehyd Epimerase RmlD_sub_bind Polysacc_synt_2 3Beta_HSD NAD_binding_4 adh_short KR
Motif
Other DBs
NCBI-ProteinID: ABJ07425
UniProt: Q07KV9
Position
complement(3901297..3902268)
Genome map
AA seq 323 aa AA seqDB search
MSKLILVCGGAGFLGSHLCDTLISGGDRVICLDNFQTGSRRNVRHLLEHPRFKVVTADVV
DPVDFKVDRIYNLACPASPPRYQDDPIRTIRTSVLGALNLVALAERTGARLLQASTSEVY
GDPELHPQTEEYRGNVSFVGPRACYDEGKRCAETVLFDAARAGRADVRVARIFNTYGPNM
DVADGRVVSNFAVQALRNEPISVYGKGDQTRSFCYVTDLIDGLVRLMEHPGDLPGAVNLG
NPNEMTVIELARLIIDLTGSRSRVVHLPLPKDDPTRRRPDIARAGRYLGWRPTTNLVEGL
AMTIGYFEAELERSAMPTVMDVA
NT seq 972 nt NT seq  +upstreamnt  +downstreamnt
atgagcaaacttattctggtctgcggcggcgccggtttcctcgggtcgcacctgtgcgat
acgctcatcagcggcggtgaccgggtgatttgtctcgacaattttcagaccggaagccgt
cgcaacgttcggcacttgttggagcatccgcgtttcaaggtcgtaaccgccgatgtcgtt
gacccggtcgatttcaaggtcgaccgcatctacaatctggcgtgcccggcatcgccgccg
cgctatcaggatgatccgatccgaacgatccgcaccagtgtgctcggcgcgctcaacctg
gtcgcccttgcggaacgcaccggcgcgcgtttgctgcaagcatcgacgagcgaagtctac
ggtgacccggaattgcacccgcagaccgaggaataccgcggcaacgttagtttcgtcggc
ccgcgcgcctgctacgatgaggggaagcgctgcgccgagacagtcctgttcgatgccgcc
cgcgccggacgggctgacgtccgggttgcgcggatattcaatacgtacggaccgaacatg
gacgtcgccgacggacgcgtggtgagcaattttgcggttcaggcactgcgcaacgagccc
atttcggtgtatggcaagggcgaccagacgaggtcgttctgctacgtcaccgacctgatc
gacgggctggtccgattgatggagcaccccggcgacttgcctggagcggtcaatctcggc
aatcccaacgagatgacggtgatcgaattggcgcgcctcatcatcgatctcacgggatcg
cgatcacgcgtcgtgcacttgccgctgccgaaggacgatccgacgcggcggcgaccggat
attgcgcgcgcagggcgctatctcggctggcgtccgaccaccaacctggtcgaggggttg
gcaatgaccatcggatatttcgaagcggaactggagcggtcggcaatgccgaccgtgatg
gacgtcgcatga

DBGET integrated database retrieval system