KEGG   Rhodopseudomonas palustris BisA53: RPE_4011
Entry
RPE_4011          CDS       T00400                                 
Name
(GenBank) conjugation TrbI family protein
Organism
rpe  Rhodopseudomonas palustris BisA53
SSDB
Motif
Pfam: TrbI gp12-short_mid
Other DBs
NCBI-ProteinID: ABJ07937
UniProt: Q07JE7
Position
complement(4496702..4496959)
AA seq 85 aa
MRTFKAALLSTLLGVGTELGSSMSTSGNNADIVQALRRGSSDSLNQTGQQVVRRNLNIQP
TLTIRPGFPVRVIVNRDLVLEPYKG
NT seq 258 nt   +upstreamnt  +downstreamnt
atgcgtacgttcaaggccgcgctgctttcgactttgctcggcgttggaactgaacttgga
tccagcatgagcacgagcggtaacaacgcagacatcgttcaggcccttcgacgcgggtca
agcgacagtctgaatcagaccggtcagcaagtggttcgacgtaatctcaatatccagccg
accttgacaatccggccgggatttccggtgcgcgtgatcgtcaaccgggacctcgtgctc
gaaccttacaaaggttag

DBGET integrated database retrieval system