KEGG   Rhodopseudomonas palustris BisA53: RPE_4015
Entry
RPE_4015          CDS       T00400                                 
Name
(GenBank) conjugation TrbI family protein
  KO
K20533  type IV secretion system protein TrbI
Organism
rpe  Rhodopseudomonas palustris BisA53
Pathway
rpe02024  Quorum sensing
Brite
KEGG Orthology (KO) [BR:rpe00001]
 09140 Cellular Processes
  09145 Cellular community - prokaryotes
   02024 Quorum sensing
    RPE_4015
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02044 Secretion system [BR:rpe02044]
    RPE_4015
Secretion system [BR:rpe02044]
 Type IV secretion system
  Trb secretion system protein
   RPE_4015
SSDB
Motif
Pfam: TrbI
Other DBs
NCBI-ProteinID: ABJ07941
UniProt: Q07JE3
Position
complement(4499351..4500454)
AA seq 367 aa
MSGGADDARVEPEPVASMRLRAERPRVTRLSRKVLAGGAAVGTFAIFGAVLWALQNNRSR
TTQSSELYTTEHRQVADGLTGLPRDYAGVPRQAPPLGPALPGDLGRPILRAQNAPSTLIP
GADQEQQRQSQEIEAARLSRLFASTNIRDLPMPALQPVATDSSATTTSQPAHPAADDAFA
QNGQDRKLAFVNGPINRRTTSPDRVAAPASAYVVQAGNVIPASLITGIRSDLPGQITAQV
TENIYDSPTGRWLLVPQGARLIGIYDSQIAFGQSRVLLVWTRLIMPNGRSIVLERQPGAD
TAGYAGLEDGVDQHWGALFKGTHPTSAVLSDTGDFAKRVTLSLALRSSSDAGRCVGRVGA
TAALVAG
NT seq 1104 nt   +upstreamnt  +downstreamnt
atgagcggaggagccgacgacgctcgcgttgaacccgaaccggtcgcatcgatgcgattg
cgggcagagcgcccacgggtgacgcgattgtcacgcaaggtgctggcaggaggtgcggcc
gtcgggacatttgcgatcttcggtgcggtgctatgggcgctgcagaacaatcgatcgcgc
accacacaatcaagcgaactctacaccaccgagcatcgccaggttgcggatggattgact
ggattgccgcgcgactatgccggggtgccgcggcaggcgcctccacttggaccggcgtta
ccgggcgatctcggccggccgatcctgcgcgcgcaaaatgcgccgtcgacactcataccc
ggcgccgatcaagagcagcagcgccagagccaggagatcgaagcagcgcggctcagccgg
ctgtttgcttcgaccaatattcgggacttgccgatgccggcgctgcaaccagttgcgact
gattcatcagcgacaaccacgagccagcctgctcaccccgcggccgacgacgcttttgct
cagaatggccaggaccgcaagctcgccttcgtcaatggcccgatcaatcgccgaaccacc
agtcccgaccgggtcgcggcgcccgcgtcagcctatgtggtgcaggccggcaacgtcatc
ccggcgtcgctcatcaccggaattcggtcggatttgcccggccaaatcaccgcgcaggtg
acagaaaatatttatgatagtccaaccgggcgttggctgctcgttccgcagggggcccgg
ctaataggaatttatgatagccaaattgcgttcggtcagtcccgggtgctgcttgtctgg
acccgcctcatcatgccgaacggccgatcgatcgtgctggagcgacagcctggcgctgac
accgccggctacgcggggctcgaagatggagtcgatcaacattggggtgccttgttcaag
ggtacgcatccgacgagcgccgtcttgtctgatacgggggatttcgcgaagcgtgtgacc
ttaagtctagctttaaggtcatcaagcgatgcgggtcgatgtgttgggcgggttggagcg
acggcggcgctggtcgcaggatga

DBGET integrated database retrieval system