KEGG   Rhodopseudomonas palustris BisA53: RPE_4020
Entry
RPE_4020          CDS       T00400                                 
Name
(GenBank) putative conjugal transfer protein TrbJ
  KO
K20266  type IV secretion system protein TrbJ
Organism
rpe  Rhodopseudomonas palustris BisA53
Pathway
rpe02024  Quorum sensing
Brite
KEGG Orthology (KO) [BR:rpe00001]
 09140 Cellular Processes
  09145 Cellular community - prokaryotes
   02024 Quorum sensing
    RPE_4020
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02044 Secretion system [BR:rpe02044]
    RPE_4020
Secretion system [BR:rpe02044]
 Type IV secretion system
  Trb secretion system protein
   RPE_4020
SSDB
Motif
Pfam: DUF4141 DUF948
Other DBs
NCBI-ProteinID: ABJ07946
UniProt: Q07JD8
Position
complement(4503669..4504397)
AA seq 242 aa
MIRRNLVTASAIALTIATVPSRAQVVVFDPNNYVQNVLTAARALQQINNQITSLQNQAQM
LINQARNLASLPYSSLQQLQSSIQRTQQLLVQAQRIAYDIQQIDRAFSTTYAPASAGVSS
QALIGNAQQRWQTSLAALQDALRVQAGVVGNLDTHRSEMSALVTSSQSATGALQATQAGN
QLIALQGQQLADLTATVAAQGRAASLDAAQRSAAQDQGREQLRRFLTPGVGYQPTNVQMF
HQ
NT seq 729 nt   +upstreamnt  +downstreamnt
atgatccgccgcaacctcgtcacggcgagcgccatagctctcaccattgcgactgtgcca
tcccgggcgcaggtggtggtgttcgacccgaacaactacgtccagaatgtgctgacggcg
gcgcgcgcgctgcaacagatcaacaaccagatcacctcgctgcagaatcaggcgcagatg
ttgatcaatcaggcgaggaatctggccagcctgccatattcctcgttgcagcagttgcaa
tcgtcgatccagcgcactcagcagcttctcgtgcaagcgcagcgcatcgcctacgacatc
cagcagatcgaccgggcgttctcgaccacctatgcgccggcatctgcgggagtatcaagc
caggcgctgatcggcaatgcgcagcagcgttggcagacctctctcgcagccttgcaggat
gcgctgcgggtccaggccggtgtggtcggcaatctcgacacccatcgcagcgagatgtcg
gcgctggtgacgtcgagccagtccgcgaccggcgcgctgcaggccacccaagccggtaat
cagctgatcgctttgcagggccagcagctcgctgatctgaccgcgaccgtcgcggctcaa
ggacgggccgcgagcctggatgccgcccaacgcagtgccgcgcaggatcagggcagggag
caactccgccgcttcctgacgcctggcgttggctatcagcccaccaacgttcagatgttc
caccaatga

DBGET integrated database retrieval system