KEGG   Rhodopseudomonas palustris BisA53: RPE_4340Help
Entry
RPE_4340          CDS       T00400                                 

Definition
(GenBank) homoserine O-acetyltransferase
  KO
K00641  homoserine O-acetyltransferase/O-succinyltransferase [EC:2.3.1.31 2.3.1.46]
Organism
rpe  Rhodopseudomonas palustris BisA53
Pathway
rpe00270  Cysteine and methionine metabolism
rpe00920  Sulfur metabolism
rpe01100  Metabolic pathways
rpe01110  Biosynthesis of secondary metabolites
rpe01130  Biosynthesis of antibiotics
Brite
KEGG Orthology (KO) [BR:rpe00001]
 09100 Metabolism
  09102 Energy metabolism
   00920 Sulfur metabolism
    RPE_4340
  09105 Amino acid metabolism
   00270 Cysteine and methionine metabolism
    RPE_4340
Enzymes [BR:rpe01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.31  homoserine O-acetyltransferase
     RPE_4340
    2.3.1.46  homoserine O-succinyltransferase
     RPE_4340
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Abhydrolase_1 Hydrolase_4 HTH_AraC
Motif
Other DBs
NCBI-ProteinID: ABJ08264
UniProt: Q07IH0
Position
complement(4865304..4866506)
Genome map
AA seq 400 aa AA seqDB search
MPGRNPLKKPLVKIDEREREADHPSSEVALFSRDEPLRLDCGIDLSPFQIAYKTYGTLNA
DKSNAILVCHALTGDQHVANTHPVTGKPGWWQTLVAPGRPLDPERYFIICSNVLGGCMGS
TGPASTNPATGHPWGLDFPVITIPDMVRAQAMLIDRLGIDKLFCVVGGSMGGMQTLQWTV
AYPERVFSALAVACATRHSAQNIAFHELGRQAVMADPDWLHGRYFDEGAHPHRGLAVARM
AAHITYLSDAALHRKFGRRMQDRELPTFSFDADFQVESYLRYQGSSFVERFDANTYLYLT
RAMDYFDIAADHQGVLAQAFRGTKTRFCVVSFTSDWLFPTSESRAIVHALNAGGARVSFA
EIETDRGHDAFLLDVPEFIDIARAFLHSAGTANGLAGKDH
NT seq 1203 nt NT seq  +upstreamnt  +downstreamnt
atgccgggtcgaaatccattgaaaaagcccttggtgaaaatcgacgagcgcgaacgcgaa
gccgaccatccgtcctcggaggtggcgctgttctctcgagacgagccgctgcggctggat
tgcggcatcgatctttcgccgttccagatcgcctacaagacctatggcacgctcaacgcc
gacaagagcaacgccatcctggtctgccacgcgctgaccggcgaccagcacgtcgccaac
acccacccggtcaccggcaagccgggctggtggcagaccctggtcgcccccggcaggccg
ctcgaccccgagcgctatttcatcatctgctccaacgtgctgggcggctgcatgggctcg
accggcccggcctccaccaaccccgccaccggccacccgtgggggctggatttcccggtc
atcaccatccccgacatggtccgggcccaggcgatgctgatcgaccggctcggcatcgac
aaattgttctgcgtggtcggcggctcgatgggcggcatgcagacgctgcaatggaccgtg
gcctatccggagcgggtgttttccgcgctggcggtggcctgcgcgacgcggcactcggcg
caaaacatcgccttccacgaactcggccgccaggcggtgatggccgatccggactggctg
catggccgctatttcgacgagggcgcccacccccaccgcggccttgcggtggcgcggatg
gccgcgcacatcacctatctctccgacgccgccttgcatcgcaagttcgggcgccggatg
caggaccgcgaactgccgacgttctcattcgacgccgatttccaggtcgagagctatctg
cgctatcagggctcgtccttcgtcgagcgattcgatgccaacacttatctctatctgacg
cgtgcgatggactatttcgacatcgccgcggaccaccagggcgtgctggcgcaggcgttt
cgcggcaccaagacgcggttctgcgtggtgtcgttcacctcggactggctgtttccgacc
tcggaatcccgcgccatcgtgcacgcgctgaacgccggcggcgcgcgggtgtcgttcgcc
gagatcgagaccgatcgcggccacgacgccttcctgctcgacgtgccggagttcatcgac
atcgcgcgtgcctttttgcattcggccggcaccgccaacggcctcgccggcaaggaccat
tga

DBGET integrated database retrieval system