KEGG   Ralstonia pickettii 12D: Rpic12D_0228Help
Entry
Rpic12D_0228      CDS       T00925                                 

Definition
(GenBank) phosphoglycerate mutase 1 family
  KO
K01834  2,3-bisphosphoglycerate-dependent phosphoglycerate mutase [EC:5.4.2.11]
Organism
rpf  Ralstonia pickettii 12D
Pathway
rpf00010  Glycolysis / Gluconeogenesis
rpf00260  Glycine, serine and threonine metabolism
rpf00680  Methane metabolism
rpf01100  Metabolic pathways
rpf01110  Biosynthesis of secondary metabolites
rpf01120  Microbial metabolism in diverse environments
rpf01130  Biosynthesis of antibiotics
rpf01200  Carbon metabolism
rpf01230  Biosynthesis of amino acids
Module
rpf_M00001  Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
rpf_M00002  Glycolysis, core module involving three-carbon compounds
rpf_M00003  Gluconeogenesis, oxaloacetate => fructose-6P
Brite
KEGG Orthology (KO) [BR:rpf00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    Rpic12D_0228
  Energy metabolism
   00680 Methane metabolism
    Rpic12D_0228
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    Rpic12D_0228
Enzymes [BR:rpf01000]
 5. Isomerases
  5.4  Intramolecular transferases
   5.4.2  Phosphotransferases (phosphomutases)
    5.4.2.11  phosphoglycerate mutase (2,3-diphosphoglycerate-dependent)
     Rpic12D_0228
Membrane trafficking [BR:rpf04131]
 Autophagy
  Chaperone mediated autophagy (CMA)
   Selective cargos
    Rpic12D_0228
Exosome [BR:rpf04147]
 Exosomal proteins
  Exosomal proteins of bladder cancer cells
   Rpic12D_0228
  Exosomal proteins of melanoma cells
   Rpic12D_0228
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: His_Phos_1
Motif
Other DBs
NCBI-ProteinID: ACS61536
UniProt: C6BBC4
Position
1:complement(242096..242851)
Genome map
AA seq 251 aa AA seqDB search
MAVMHKLVLIRHGESTWNLENRFTGWVDVDLTDTGVAQARQGGKLLREAGFTFDLAYTSV
LKRAIRTLWHVQDEMDLMWIPTRNEWRLNERHYGALSGLNKAETAAQYGDEQVLVWRRSY
DTPPPALEPGADNDAFGNPRYAGLTREQVPLTECLKDTVARVMPLWEESIAPAIKSGKRV
VIAAHGNSIRALVKYLDGISDADIVGLNIPNGTPLVYELDANLKPIRHYYLGDQEAIAAS
LAAVASQGKSK
NT seq 756 nt NT seq  +upstreamnt  +downstreamnt
atggcagtcatgcataagctcgtcctcatccgccacggcgaatcgacgtggaatctggag
aatcgcttcaccggctgggtcgacgtcgacctgaccgacacgggcgtcgcccaggcccgc
caaggcggcaaactgctgcgcgaagccggcttcaccttcgatctggcctacacctcggtg
ctcaagcgtgcgatccgcacgctctggcatgtgcaggatgaaatggacctgatgtggatc
ccgacccgcaacgaatggcggctgaacgagcgccactacggcgcgctgtcgggcctgaac
aaggccgaaaccgccgcgcaatatggcgacgagcaagtcctcgtctggcgccgcagctac
gacacgccgccgcccgcactggagcccggcgccgacaacgacgctttcggcaacccgcgt
tacgcgggactcacgcgcgagcaggtacccctgaccgaatgcctgaaggacacggtcgca
cgcgtcatgccgctgtgggaagaatcgattgcaccagccatcaagagcggcaagcgcgtg
gtgatcgccgcgcacggcaacagcatccgcgcgctggtgaaatacctggacggcatttcc
gatgcggacatcgtcggcctgaacattcccaacggcacgccgcttgtgtatgagctggac
gccaacctcaagccgatccgccattactacctgggcgaccaggaagcgattgccgcgtcg
ctcgcggcggtggccagccaaggcaagtcgaaataa

DBGET integrated database retrieval system