KEGG   Ralstonia pickettii 12D: Rpic12D_0276
Entry
Rpic12D_0276      CDS       T00925                                 

Definition
(GenBank) ribosomal 5S rRNA E-loop binding protein Ctc/L25/TL5
  KO
K02897  large subunit ribosomal protein L25
Organism
rpf  Ralstonia pickettii 12D
Pathway
rpf03010  Ribosome
Brite
KEGG Orthology (KO) [BR:rpf00001]
 09120 Genetic Information Processing
  09122 Translation
   03010 Ribosome
    Rpic12D_0276
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03011 Ribosome [BR:rpf03011]
    Rpic12D_0276
Ribosome [BR:rpf03011]
 Ribosomal proteins
  Bacteria
   Large subunit
    Rpic12D_0276
SSDB
Motif
Pfam: Ribosomal_TL5_C Ribosomal_L25p
Other DBs
NCBI-ProteinID: ACS61583
UniProt: C6BBH1
Position
1:complement(285907..286533)
AA seq 208 aa
MKVVAFERSVQGTGASRRLRNSGKTPAIIYGAGAEPKLIELDHNALYHALKKEAFHSSIL
DIEVAGKVEKALLRDFQLHPFKQLVLHVDFQRVSAKEKIHVKVPLHFLNQETAPGVKLGH
GIVNHILNDVEVSCLPADLPEFIEVDLGTLEIGQTLHIADLKLPKGVTILTHGGDENPAV
ANISVPAGEKSAAAEEGAAAAGEDKPAA
NT seq 627 nt   +upstreamnt  +downstreamnt
atgaaagttgtcgctttcgagcgtagcgttcagggcactggtgcgagccgccgcctgcgc
aattccggcaagaccccggcgatcatttacggcgctggcgccgagccgaagctgatcgaa
ctcgatcacaacgcgctgtaccacgcgctgaagaaggaagccttccactcgtcgatcctc
gacatcgaagtggctggcaaggtggaaaaggcgctgctgcgcgacttccaactgcacccg
ttcaagcaactggttctgcacgtcgatttccaacgtgtatcggccaaggaaaagatccac
gtcaaggtgccgctgcacttcctgaaccaggaaaccgcaccgggcgtgaagctgggccac
ggcatcgtgaaccacatcctgaacgacgtcgaagtgtcgtgcctgccggccgacctgccg
gagttcatcgaagtggatctgggtacgctggaaatcggccagaccctgcacatcgctgac
ctcaagctgccgaagggcgtgaccatcctcacccacggtggcgatgagaacccggctgtt
gccaacatcagcgtgccggctggcgagaagtccgctgccgccgaagaaggcgctgctgct
gcaggcgaagacaagccggcagcctaa

DBGET integrated database retrieval system