KEGG   Ralstonia pickettii 12D: Rpic12D_0278Help
Entry
Rpic12D_0278      CDS       T00925                                 

Definition
(GenBank) 4-diphosphocytidyl-2C-methyl-D-erythritol kinase
  KO
K00919  4-diphosphocytidyl-2-C-methyl-D-erythritol kinase [EC:2.7.1.148]
Organism
rpf  Ralstonia pickettii 12D
Pathway
rpf00900  Terpenoid backbone biosynthesis
rpf01100  Metabolic pathways
rpf01110  Biosynthesis of secondary metabolites
rpf01130  Biosynthesis of antibiotics
Brite
KEGG Orthology (KO) [BR:rpf00001]
 Metabolism
  Metabolism of terpenoids and polyketides
   00900 Terpenoid backbone biosynthesis
    Rpic12D_0278
Enzymes [BR:rpf01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.148  4-(cytidine 5'-diphospho)-2-C-methyl-D-erythritol kinase
     Rpic12D_0278
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: GHMP_kinases_N GHMP_kinases_C
Motif
Other DBs
NCBI-ProteinID: ACS61585
UniProt: C6BBH3
Position
1:complement(287842..288711)
Genome map
AA seq 289 aa AA seqDB search
MSSAPVELRDCPAPAKLNLFLHVVGRRPDGYHLLQTVFQLIDWSDTLHFARRPDGRLVRT
TDIPGVHADDDLVIRAARLLQAETGCTYGVDIAIEKRLPMGGGLGGGSSDAATTLLALNR
LWGLDLPRTQLMAIGLKLGADVPFFVFGQNAFAEGIGEELTPVTLPPAAFVVIHPRVHVP
TPAIFSDEGLTRDTPLTIITDFPDQQIVFAYGRNDLQAVAERKYGEIARALVWLRQFSPL
ARMTGSGACVFAPFDNVEQAQAVADQVPSEWEGRCAAGLSQHPLARFAV
NT seq 870 nt NT seq  +upstreamnt  +downstreamnt
atgtcttccgcccccgtcgagctgcgtgattgccccgcgcccgccaagctcaatctcttc
ctgcatgtagtcggccgccggccagatggctaccacctgctgcaaaccgtcttccagttg
atcgactggagcgacacgctgcatttcgcgcgccgccccgacggccgcctcgtgcgcacc
accgacatccccggcgtgcacgccgatgacgaccttgtgatccgcgccgcgcgcctgctg
caagcggaaaccggctgcacctacggcgtcgacatcgcgatcgagaaacgcctgccgatg
ggcggtggccttggcggcggctcgtctgatgctgccaccacgctgcttgcgctcaatcgt
ctctggggccttgatctgccacgcacgcaactgatggcgatcggcctgaagctgggcgcc
gacgtgcccttcttcgtgttcggccagaacgccttcgccgaggggatcggcgaagaactc
acgccggtcacgctgccgccggctgccttcgtggtgattcacccacgcgtgcatgtgccg
acccctgcaattttttccgatgaagggttgacacgcgatacgccactcaccataattacg
gactttcctgaccaacaaattgttttcgcttacggtcgcaacgacctgcaagcggtggcg
gaaaggaaatacggcgaaatcgcccgagcacttgtctggctgcgtcagttcagccctctg
gcaagaatgaccggatccggcgcctgcgtatttgctccgttcgacaacgttgagcaggcg
caagcggtggcggatcaggtgccttccgaatgggaaggtcggtgtgcggcaggtctgtcg
caacacccgctcgcaagatttgctgtgtaa

DBGET integrated database retrieval system